Player Ðepeche has no weapon equipped at the Main-Hand slot.
close

SimulationCraft 603-19

for World of Warcraft 6.0.3 Live (build level 19243)

Table of Contents

Raid Summary

 

DPS Chart
Ciaran

Ciaran : 20222 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
20221.8 20221.8 8.8 / 0.044% 2778.0 / 13.7% 36.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
553.2 553.2 Mana 0.26% 36.3 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced
Talents
  • 15: Feline Swiftness
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Force of Nature
  • 75: Incapacitating Roar
  • 90: Nature's Vigil
  • 100: Balance of Power
  • Talent Calculator
Glyphs
  • Glyph of Guided Stars
  • Glyph of Rebirth
  • Glyph of Stars
  • Glyph of the Chameleon
  • Glyph of the Stag
Professions
  • leatherworking: 2
  • skinning: 288

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ciaran+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x120&chd=t:30327|15391|11487&chds=0,60653&chco=8AD0B1,69CCF0,ABD473&chm=t++30327++starsurge,8AD0B1,0,0,15|t++15391++starfire,69CCF0,1,0,15|t++11487++wrath,ABD473,2,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:34,20,20,13,12,2,1&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,69CCF0,ABD473,C79C6E,ABD473&chl=starfire|wrath|starsurge|moonfire|sunfire|shattered_bleed|treant: wrath&
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ciaran+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:abgimrty036468567512yzvvsnniigfffeeddcbbaaaZaaabcaZZaZZaaacbbcbccbaaabcaabbaZYYYXYYYYYaaaZYZaZZabbbbcbbbbbaZZabbabbaZZZZZZZZZabccbbbcabccdcdccdddcbaabccbcbbaaaZZZZZZZabbaZaaZaacddefggijkklnoppppppoonmljigggfddccbaaaZZZZYZaaaaZabaaaababbbbbcbaZaaaaaaaaZZaZZZZZZabbcbbccbbcccccccccccbaabaaZaaZZZZZZZZZYZabbaabbbabbbbbcbbbcbaZZaaZZaZZZZZYYYZYYZaaaaaabaaabaaabaaaaaZYXWVTSQPNMLK&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.503638,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=20222|max=40151&chxp=1,1,50,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ciaran+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,6,7,16,26,47,84,119,214,287,423,583,699,843,1041,1201,1402,1441,1521,1593,1668,1590,1494,1323,1326,1134,915,854,690,550,470,369,283,217,171,119,83,53,46,43,22,10,4,2,6,0,0,2,2&chds=0,1668&chbh=5&chxt=x&chxl=0:|min=17724|avg=20222|max=23451&chxp=0,1,44,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:43.9,35.6,13.0,3.6,3.4,0.3&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,ABD473,69CCF0,ffffff&chl=starfire 132.0s|wrath 107.2s|starsurge 39.1s|sunfire 10.8s|moonfire 10.3s|waiting 0.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ciaran 20222
moonfire 2526 12.5% 9.0 35.00sec 84246 73500 Direct 9.0 4790 9173 5348 12.7% 1.8 1607 3174 12.4%  
Periodic 175.7 3324 6748 3766 12.9% 40.2 1003 2033 12.8% 99.0%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.01 9.01 175.68 175.68 1.1462 1.6953 758744.15 758744.15 0.00 2462.20 73500.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.23 12.35% 3173.68 2058 7708 645.05 0 7708 716 716 0.00
multistrike 1.60 87.65% 1606.77 1029 3854 1291.66 0 3854 2573 2573 0.00
hit 7.86 87.27% 4790.15 0 12846 4750.20 1797 7506 37650 37650 0.00
crit 1.15 12.73% 9172.78 0 25692 6434.88 0 25692 10514 10514 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.2 12.84% 2033.32 1193 6123 2024.60 0 6123 10496 10496 0.00
multistrike 35.1 87.16% 1003.02 596 3062 1005.07 727 1385 35157 35157 0.00
hit 153.0 87.09% 3324.24 30 10206 3330.75 3064 3646 508625 508625 0.00
crit 22.7 12.91% 6748.00 46 20411 6763.18 4749 9864 153010 153010 0.00
 
DPS Timeline Chart
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:40.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 384 1.9% 17.4 17.57sec 6634 0 Direct 17.4 1616 3249 1824 12.7% 4.0 485 975 12.7%  
Periodic 97.2 783 0 783 0.0% 22.3 238 0 0.0% 32.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 97.25 97.25 0.0000 1.0000 115441.02 115441.02 0.00 1187.12 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.51 12.71% 974.72 952 1142 387.68 0 1142 496 496 0.00
multistrike 3.49 87.29% 484.91 476 571 467.98 0 571 1695 1695 0.00
hit 15.18 87.25% 1616.36 1586 1904 1616.55 1586 1759 24540 24540 0.00
crit 2.22 12.75% 3248.78 3173 3807 2906.11 0 3807 7208 7208 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 22.3 100.00% 237.96 238 238 237.96 238 238 5312 5312 0.00
hit 97.2 100.00% 783.49 1 793 783.77 754 793 76191 76191 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
starfire 6785 33.5% 52.7 5.60sec 38576 15391 Direct 52.7 31712 65099 36094 13.1% 12.1 9509 19543 13.0%  

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.68 52.68 0.00 0.00 2.5064 0.0000 2032044.38 2032044.38 0.00 15390.89 15390.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.57 12.98% 19542.80 10830 28949 15493.11 0 28949 30673 30673 0.00
multistrike 10.52 87.02% 9508.75 5264 14474 9528.81 0 14474 100071 100071 0.00
hit 45.76 86.88% 31711.97 17546 48248 31779.93 27996 35831 1451237 1451237 0.00
crit 6.91 13.12% 65099.00 35092 96495 65234.93 0 96495 450063 450063 0.00
 
DPS Timeline Chart
 

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that causes {$s1=1 + 187.2%} Arcane damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.340000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
starsurge 3950 19.5% 30.7 10.03sec 38648 30327 Direct 30.5 31951 65312 36323 13.1% 7.0 9581 19554 13.1%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.67 30.54 0.00 0.00 1.2744 0.0000 1185467.89 1185467.89 0.00 30326.63 30326.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.92 13.06% 19553.76 14864 27833 11692.12 0 27833 17905 17905 0.00
multistrike 6.10 86.94% 9580.84 7432 13917 9554.88 0 13917 58403 58403 0.00
hit 26.53 86.89% 31950.71 24773 46389 31994.38 29038 35945 847791 847791 0.00
crit 4.00 13.11% 65311.71 49547 92778 64273.19 0 92778 261369 261369 0.00
 
DPS Timeline Chart
 

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.down&eclipse_energy>20
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:Instantly causes {$78674s1=2242} Spellstorm damage to the target, benefiting from your strongest current Eclipse bonus. Also grants Lunar or Solar Empowerment, based on current Balance Energy side, which increases the damage of your next $164547n Starfires or $164545n Wraths by {$164545s1=30}%. Max 3 charges. Charges shared with Starfall.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.925000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
sunfire 2349 11.6% 9.5 32.37sec 74036 65348 Direct 9.5 7030 14202 7925 12.5% 2.0 2344 4639 12.8%  
Periodic 169.2 3050 6227 3459 12.9% 38.7 916 1867 12.9% 96.1%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.54 9.54 169.20 169.20 1.1330 1.7096 706215.39 706215.39 0.00 2353.50 65347.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.25 12.77% 4639.35 2058 5229 1030.65 0 5229 1166 1166 0.00
multistrike 1.72 87.23% 2343.76 1029 2615 1951.22 0 2615 4024 4024 0.00
hit 8.35 87.53% 7030.49 0 8716 7012.30 3286 8716 58701 58701 0.00
crit 1.19 12.47% 14202.30 0 17431 10200.19 0 17431 16891 16891 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.0 12.86% 1867.13 1193 4155 1854.87 0 4155 9298 9298 0.00
multistrike 33.7 87.14% 916.15 596 2077 917.43 731 1192 30904 30904 0.00
hit 147.4 87.12% 3049.64 1412 6924 3053.68 2869 3302 449547 449547 0.00
crit 21.8 12.88% 6227.14 2824 13848 6235.80 4377 8532 135685 135685 0.00
 
DPS Timeline Chart
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1056.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<7|buff.solar_peak.up
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every {$t2=0} seconds.
  • description:A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
wrath 4079 20.3% 61.6 4.27sec 20001 11487 Direct 61.3 16754 33546 18809 12.2% 14.0 5024 10070 12.2%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.56 61.26 0.00 0.00 1.7412 0.0000 1231219.70 1231219.70 0.00 11486.65 11486.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.71 12.19% 10070.47 6854 12275 8181.33 0 12275 17192 17192 0.00
multistrike 12.30 87.81% 5024.03 3427 6953 5026.01 3721 6031 61799 61799 0.00
hit 53.76 87.76% 16754.06 11424 23176 16762.07 15135 18787 900747 900747 0.00
crit 7.50 12.24% 33546.14 22847 44932 33539.26 0 40916 251482 251482 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:A Solar spell that causes {$s1=1121} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.462500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - treant 207 / 148
wrath 207 0.7% 102.3 3.12sec 435 204 Direct 101.8 362 728 409 12.8% 23.4 109 218 12.8%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.29 101.85 0.00 0.00 2.1313 0.0000 44516.65 44516.65 0.00 204.19 204.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.00 12.83% 218.27 211 259 207.45 0 259 655 655 0.00
multistrike 20.37 87.17% 108.60 105 129 108.63 105 118 2212 2212 0.00
hit 88.77 87.16% 362.00 351 431 362.13 356 372 32134 32134 0.00
crit 13.08 12.84% 727.62 702 862 728.00 702 862 9516 9516 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:113769
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113769
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Causes {$s1=180} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Ciaran
celestial_alignment 2.0 181.80sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.74 86.77% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.27 13.23% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: celestial_alignment

Static Values
  • id:112071
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:eclipse_energy>40
Spelldata
  • id:112071
  • name:Celestial Alignment
  • school:physical
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
force_of_nature 16.8 19.73sec

Stats details: force_of_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.79 16.79 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.68 87.44% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.11 12.56% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: force_of_nature

Static Values
  • id:33831
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:trinket.stat.intellect.up|charges=3|target.time_to_die<21
Spelldata
  • id:33831
  • name:Force of Nature
  • school:nature
  • tooltip:
  • description:Summons a Treant which will immediately root your current target for {$113770d=30 seconds}. The Treant will cast Wrath at that target for {$113769s1=180} Nature damage every 2 sec. Lasts {$d=15 seconds}. Maximum 3 charges.
 
moonkin_form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.89 89.48% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.11 10.52% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2976.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 25.01% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.0 0.0 181.8sec 181.8sec 10.15% 18.63% 300.2(300.2)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • celestial_alignment_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
draenic_intellect_potion 2.0 0.0 186.3sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lunar_empowerment 18.2 1.1 16.6sec 16.2sec 65.36% 68.82% 1.1(1.3)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_empowerment
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lunar_empowerment_1:25.37%
  • lunar_empowerment_2:39.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Starfire is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Starfires within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_peak 7.1 0.0 42.5sec 42.5sec 9.86% 11.43% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_peak
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • lunar_peak_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171743
  • name:Lunar Peak
  • tooltip:Increases the damage of your next Moonfire by {$s1=100}%.
  • description:{$@spelldesc8921=A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
nightmare_fire 2.8 0.0 125.8sec 125.9sec 18.05% 18.06% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
solar_empowerment 10.8 0.6 24.2sec 22.8sec 40.48% 45.10% 0.6(1.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • solar_empowerment_1:11.69%
  • solar_empowerment_2:13.13%
  • solar_empowerment_3:15.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Wraths within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
solar_peak 6.6 0.0 42.7sec 42.7sec 1.28% 5.57% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • solar_peak_1:1.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171744
  • name:Solar Peak
  • tooltip:Increases the damage of your next Sunfire by {$s1=100}%.
  • description:{$@spelldesc93402=A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
moonkin_form

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ciaran
moonfire Mana 8.0 8454.5 1056.0 938.7 89.7
starfire Mana 52.7 50569.4 960.0 960.0 40.2
starsurge Mana 30.7 29446.5 960.0 960.0 40.3
sunfire Mana 8.6 9082.6 1056.0 952.2 77.8
wrath Mana 61.6 68945.3 1120.0 1120.0 17.9
Resource Gains Type Count Total Average Overflow
yseras_gift Health 4.41 0.00 (0.00%) 0.00 42248.31 100.00%
energy_regen Energy 169.04 0.00 (0.00%) 0.00 3534.04 100.00%
external_healing Health 4.30 0.00 (0.00%) 0.00 38687.91 100.00%
mp5_regen Mana 169.04 166289.03 (100.00%) 983.71 539736.77 76.45%
leech Health 762.77 0.00 (0.00%) 0.00 39901.89 100.00%
Resource RPS-Gain RPS-Loss
Mana 552.54 553.24
Combat End Resource Mean Min Max
Mana 159783.65 158880.00 160000.00
Eclipse 8.63 -105.00 105.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 79.6%
treant-Mana Cap 79.6%
treant-Mana Cap 79.6%
treant-Mana Cap 79.6%
treant-Mana Cap 79.6%

Procs

Count Interval
Shooting Stars overflow (buff already up) 0.1 60.1sec
Shooting Stars 19.4 14.7sec
wrong_eclipse_wrath 0.0 135.0sec
wrong_eclipse_starfire 0.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Ciaran Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Ciaran Damage Per Second
Count 25000
Mean 20221.78
Minimum 17724.40
Maximum 23450.72
Spread ( max - min ) 5726.32
Range [ ( max - min ) / 2 * 100% ] 14.16%
Standard Deviation 710.3954
5th Percentile 19103.70
95th Percentile 21438.16
( 95th Percentile - 5th Percentile ) 2334.46
Mean Distribution
Standard Deviation 4.4929
95.00% Confidence Intervall ( 20212.97 - 20230.58 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4740
0.1 Scale Factor Error with Delta=300 4308
0.05 Scale Factor Error with Delta=300 17232
0.01 Scale Factor Error with Delta=300 430808
Distribution Chart
DPS(e)
Sample Data Ciaran Damage Per Second (Effective)
Count 25000
Mean 20221.78
Minimum 17724.40
Maximum 23450.72
Spread ( max - min ) 5726.32
Range [ ( max - min ) / 2 * 100% ] 14.16%
Damage
Sample Data Ciaran Damage
Count 25000
Mean 6029132.53
Minimum 4334044.20
Maximum 7910295.48
Spread ( max - min ) 3576251.28
Range [ ( max - min ) / 2 * 100% ] 29.66%
DTPS
Sample Data Ciaran Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ciaran Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ciaran Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ciaran Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ciaran Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ciaran Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CiaranTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ciaran Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 moonkin_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=draenic_intellect,if=buff.celestial_alignment.up
8 0.00 blood_fury,if=buff.celestial_alignment.up
9 0.00 berserking,if=buff.celestial_alignment.up
A 0.00 arcane_torrent,if=buff.celestial_alignment.up
B 16.79 force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
C 0.00 call_action_list,name=single_target,if=active_enemies=1
D 0.00 call_action_list,name=aoe,if=active_enemies>1
actions.single_target
# count action,conditions
E 17.12 starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
F 10.54 starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
G 3.01 starsurge,if=(charges=2&recharge_time<6)|charges=3
H 2.01 celestial_alignment,if=eclipse_energy>40
I 0.00 incarnation,if=eclipse_energy>0
J 8.60 sunfire,if=remains<7|buff.solar_peak.up
K 0.00 stellar_flare,if=remains<7
L 8.01 moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
M 61.93 wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
N 53.09 starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

Sample Sequence

0135BGLNHJNENNENNENBNENNNNNMJMFMMBMFJMMMFMNELNBNENNEMMMFMMBJMFMMMMNLNENBNENNMMFMMJMBMFMMMNELNNEBNNEMMMFMMJMFBMMMNLNNNH7NEBNNNNLNNNMBMMMMFJMMMMMNBNNNLNNNMMBFMMMJMMMMMNEBNNBBELNNNMMMBFMMJM

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre moonkin_form Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:01.327 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 21.7/105: 21% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:02.349 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 37.9/105: 36% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:04.391 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, lunar_empowerment, draenic_intellect_potion
0:04.391 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:05.413 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:07.454 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, draenic_intellect_potion
0:08.477 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
0:10.518 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:12.559 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, draenic_intellect_potion
0:13.581 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:15.623 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, nightmare_fire, draenic_intellect_potion
0:17.664 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, nightmare_fire, draenic_intellect_potion
0:18.688 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:20.730 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 82.3/105: 78% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:20.730 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 82.3/105: 78% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:22.770 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 98.6/105: 94% eclipse bloodlust, nightmare_fire
0:23.794 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.1/105: 98% eclipse bloodlust, lunar_empowerment(2), lunar_peak, nightmare_fire
0:25.835 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.1/105: 99% eclipse bloodlust, lunar_empowerment, lunar_peak, nightmare_fire
0:27.876 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 94.5/105: 90% eclipse bloodlust, lunar_peak, nightmare_fire
0:29.918 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 75.2/105: 72% eclipse bloodlust, nightmare_fire
0:31.959 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 48.3/105: 46% eclipse bloodlust, nightmare_fire
0:34.000 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 16.4/105: 16% eclipse bloodlust
0:35.361 sunfire Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:36.383 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:37.744 starsurge Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:38.765 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, solar_empowerment(3)
0:40.127 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, solar_empowerment(2)
0:41.489 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:41.489 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:43.259 starsurge Fluffy_Pillow 160000.0/160000: 100% mana solar_peak
0:44.585 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3)
0:45.911 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
0:47.680 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
0:49.452 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:51.223 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
0:52.550 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
0:54.319 starfire Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
0:56.969 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 32.0/105: 30% eclipse solar_empowerment(2)
0:58.296 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 52.0/105: 49% eclipse lunar_empowerment(2), solar_empowerment(2)
0:59.623 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 69.7/105: 66% eclipse lunar_empowerment(2), solar_empowerment(2)
1:02.274 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 95.5/105: 91% eclipse lunar_empowerment, solar_empowerment(2)
1:02.274 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 95.5/105: 91% eclipse lunar_empowerment, solar_empowerment(2)
1:04.925 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_peak, solar_empowerment(2)
1:06.253 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.0/105: 98% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2)
1:08.904 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 85.9/105: 82% eclipse lunar_empowerment, solar_empowerment(2)
1:11.554 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 54.1/105: 52% eclipse solar_empowerment(2)
1:12.883 Waiting 0.400 sec 160000.0/160000: 100% mana | 34.3/105: 33% eclipse lunar_empowerment(2), solar_empowerment(2)
1:13.283 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 28.0/105: 27% eclipse lunar_empowerment(2), solar_empowerment(2)
1:15.052 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
1:16.822 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:18.591 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:19.917 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
1:21.686 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
1:23.455 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak, solar_empowerment
1:23.455 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak, solar_empowerment
1:24.783 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
1:26.551 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:27.879 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
1:29.649 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
1:31.419 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
1:33.189 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:34.960 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:37.613 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 41.9/105: 40% eclipse lunar_empowerment
1:38.940 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 60.9/105: 58% eclipse lunar_empowerment
1:41.591 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 90.3/105: 86% eclipse
1:42.917 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.4/105: 95% eclipse lunar_empowerment(2)
1:45.571 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 104.6/105: 100% eclipse lunar_empowerment, lunar_peak
1:45.571 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.6/105: 100% eclipse lunar_empowerment, lunar_peak
1:48.221 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 91.8/105: 87% eclipse lunar_peak
1:49.549 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 79.3/105: 76% eclipse lunar_empowerment(2)
1:52.202 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 44.7/105: 43% eclipse lunar_empowerment
1:54.852 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 2.4/105: 2% eclipse
1:56.621 wrath Fluffy_Pillow 160000.0/160000: 100% mana
1:58.391 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
1:59.719 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
2:01.488 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
2:03.258 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment
2:04.586 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
2:06.354 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana
2:06.354 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:08.122 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
2:09.450 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
2:11.219 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
2:12.988 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
2:14.759 starfire Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:17.411 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 38.8/105: 37% eclipse nightmare_fire
2:18.739 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 58.2/105: 55% eclipse lunar_empowerment(2), nightmare_fire
2:20.068 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 75.0/105: 71% eclipse lunar_empowerment(2), nightmare_fire
2:22.719 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 98.3/105: 94% eclipse lunar_empowerment, nightmare_fire
2:25.371 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse lunar_peak, nightmare_fire
2:26.699 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 101.3/105: 96% eclipse lunar_empowerment(2), lunar_peak, nightmare_fire
2:26.699 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 101.3/105: 96% eclipse lunar_empowerment(2), lunar_peak, nightmare_fire
2:29.352 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 81.4/105: 78% eclipse lunar_empowerment
2:32.003 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 47.6/105: 45% eclipse
2:33.332 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 27.2/105: 26% eclipse lunar_empowerment(2)
2:35.102 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:36.870 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:38.639 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:39.965 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:41.733 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:43.503 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak, solar_empowerment
2:44.830 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:46.600 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:47.925 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:47.925 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:49.697 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:51.469 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:53.239 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:55.890 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 14.6/105: 14% eclipse lunar_empowerment
2:57.218 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 35.8/105: 34% eclipse lunar_empowerment
2:59.871 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 72.7/105: 69% eclipse
3:02.522 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 97.1/105: 93% eclipse
3:05.175 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_peak
3:05.175 potion Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_peak
3:05.175 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:07.826 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:09.154 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
3:09.154 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
3:11.805 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment, draenic_intellect_potion
3:14.458 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:17.108 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:19.759 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:21.087 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse draenic_intellect_potion
3:23.738 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 87.4/105: 83% eclipse draenic_intellect_potion
3:26.388 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 56.4/105: 54% eclipse draenic_intellect_potion
3:29.040 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 15.8/105: 15% eclipse draenic_intellect_potion
3:30.808 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana
3:30.808 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:32.577 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:34.346 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:36.116 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:37.886 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
3:39.216 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3)
3:40.546 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
3:42.316 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
3:44.085 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
3:45.856 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:47.626 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:49.396 starfire Fluffy_Pillow 160000.0/160000: 100% mana
3:52.048 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 33.2/105: 32% eclipse
3:52.048 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 33.2/105: 32% eclipse
3:54.700 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 70.7/105: 67% eclipse
3:57.350 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 96.0/105: 91% eclipse
4:00.000 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_peak
4:01.328 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 102.7/105: 98% eclipse
4:03.978 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 85.2/105: 81% eclipse
4:06.631 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 53.0/105: 50% eclipse
4:09.283 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 11.8/105: 11% eclipse
4:11.053 wrath Fluffy_Pillow 160000.0/160000: 100% mana
4:12.824 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:12.824 starsurge Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:14.153 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:15.923 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
4:17.692 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
4:19.462 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, nightmare_fire
4:20.788 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:22.558 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:24.326 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:26.094 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:27.864 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:29.633 starfire Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:32.283 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 36.9/105: 35% eclipse nightmare_fire
4:33.611 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 56.4/105: 54% eclipse lunar_empowerment(2)
4:33.611 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 56.4/105: 54% eclipse lunar_empowerment(2)
4:36.263 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 87.4/105: 83% eclipse lunar_empowerment
4:38.914 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse lunar_peak
4:38.914 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse lunar_peak
4:38.914 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse lunar_peak
4:40.243 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse lunar_empowerment(2), lunar_peak
4:41.571 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 101.8/105: 97% eclipse lunar_empowerment(2)
4:44.223 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 82.7/105: 79% eclipse lunar_empowerment
4:46.874 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 49.5/105: 47% eclipse
4:49.528 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 7.8/105: 7% eclipse
4:51.297 wrath Fluffy_Pillow 160000.0/160000: 100% mana
4:53.067 wrath Fluffy_Pillow 160000.0/160000: 100% mana
4:54.836 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana
4:54.836 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
4:56.163 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
4:57.932 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
4:59.702 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment
5:01.032 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 653 622 622
Agility 1352 1288 1288
Stamina 4063 3694 3694
Intellect 3870 3423 3313 (2219)
Spirit 782 782 782
Health 243780 221640 0
Mana 160000 160000 0
Eclipse 105 105 0
Spell Power 5311 4381 958
Crit 13.48% 8.48% 383
Haste 13.29% 7.90% 683
Multistrike 11.47% 6.47% 427
Damage / Heal Versatility 5.76% 2.76% 359
ManaReg per Second 2325 640 0
Mastery 44.16% 32.53% 1029
Armor 2616 872 872

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Balance Druid) Mass Entanglement Typhoon
60 Soul of the Forest Incarnation: Chosen of Elune Force of Nature
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil
100 Euphoria Stellar Flare Balance of Power

Profile

druid="Ciaran"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/225/94028513-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=leatherworking=2/skinning=288
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!0022022
glyphs=guided_stars/rebirth/stars/chameleon/stag
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/stellar_flare

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.celestial_alignment.up
actions+=/blood_fury,if=buff.celestial_alignment.up
actions+=/berserking,if=buff.celestial_alignment.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up
actions+=/force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
actions+=/call_action_list,name=single_target,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.single_target=starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
actions.single_target+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
actions.single_target+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.single_target+=/celestial_alignment,if=eclipse_energy>40
actions.single_target+=/incarnation,if=eclipse_energy>0
actions.single_target+=/sunfire,if=remains<7|buff.solar_peak.up
actions.single_target+=/stellar_flare,if=remains<7
actions.single_target+=/moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
actions.single_target+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.single_target+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

actions.aoe=celestial_alignment,if=lunar_max<8|target.time_to_die<20
actions.aoe+=/incarnation,if=buff.celestial_alignment.up
actions.aoe+=/sunfire,cycle_targets=1,if=remains<8
actions.aoe+=/starfall,if=!buff.starfall.up&active_enemies>2
actions.aoe+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.aoe+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe+=/stellar_flare,cycle_targets=1,if=remains<7
actions.aoe+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20&active_enemies=2
actions.aoe+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40&active_enemies=2
actions.aoe+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

head=alloyinlaid_cap,id=116212
neck=cratermaker_choker,id=116285
shoulders=supple_shoulderguards,id=116176,bonus_id=48/525/536
back=brilliant_hexweave_cloak,id=114819,bonus_id=170/525/537,enchant=gift_of_mastery
chest=witherleaf_chestguard,id=120088
wrists=bracers_of_determined_resolve,id=114494,bonus_id=114/560/563,gems=50mastery
hands=exceptional_crystalhide_grips,id=115388
waist=cord_of_ruination,id=115430
legs=blackwater_leggings,id=109823,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=41/102/560
finger1=darkflame_loop,id=109766,bonus_id=524,enchant=30mastery
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mastery
trinket1=emblem_of_gushing_wounds,id=116290
trinket2=sandmans_pouch,id=112320,bonus_id=525/529
main_hand=spire_of_the_furious_construct,id=110031,bonus_id=41/524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_stamina=2804
# gear_intellect=2219
# gear_spell_power=958
# gear_crit_rating=383
# gear_haste_rating=683
# gear_mastery_rating=980
# gear_armor=872
# gear_multistrike_rating=427
# gear_versatility_rating=359
# gear_leech_rating=182

Kernoris

Kernoris : 21318 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
21318.0 21318.0 9.2 / 0.043% 2927.7 / 13.7% 1335.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.9 15.9 Energy 38.85% 39.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced
Talents
  • 15: Wild Charge
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Soul of the Forest (Feral Druid)
  • 75: Mighty Bash
  • 90: Dream of Cenarius (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Glyphs
  • Glyph of Savage Roar
  • Glyph of Cat Form
  • Glyph of Ferocious Bite
  • Glyph of Grace
  • Glyph of Travel
  • Glyph of Aquatic Form
Professions
  • alchemy: 700
  • herbalism: 700

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Kernoris+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:133867|75024|45355|27967|12452|5145&chds=0,267734&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++133867++rip,C79C6E,0,0,15|t++75024++ferocious_bite,C79C6E,1,0,15|t++45355++rake,C79C6E,2,0,15|t++27967++thrash_cat,C79C6E,3,0,15|t++12452++shred,C79C6E,4,0,15|t++5145++cat_melee,C79C6E,5,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,20,19,17,17,3,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat_melee|rip|shred|ferocious_bite|rake|shattered_bleed|thrash_cat&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Kernoris+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:eimoqvy258776555221xurpoomkjiijijjjjjjjjjjjiihgfedcccdddeeefffffffggggfefddcbbaaaaabbcddddeeeeeeeeeeeeedccbaaaaabbbbcccccccddddeddeeeeeddddddddccdddddddddddddddddddddccccccbbccddefghijklnnopqrrrrrrqponmlkkjjiiihihhhhhhhhiiiihhhggffeeeefffgghhhhiiiiijjjjjjjjjiihhhhhhhiiijkkkkkkllllllllllkkjiiihhhhhiijjkkkkllmmmmmmmmmmlkkkjjjiiijjkkkllllllllkkkkkkjihhggfeeddddddfdcaZYWVTSQP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.573986,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=21318|max=37140&chxp=1,1,57,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Kernoris+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,3,9,17,25,45,49,97,156,210,297,381,505,667,808,957,1131,1284,1375,1477,1565,1505,1555,1477,1336,1249,1146,1010,842,759,662,500,424,365,243,221,178,121,124,57,54,36,22,19,16,4,7,6,0,2&chds=0,1565&chbh=5&chxt=x&chxl=0:|min=18824|avg=21318|max=24431&chxp=0,1,44,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:32.9,9.4,7.8,4.7,3.1,2.6,0.8,38.8&chds=0,100&chdls=ffffff&chco=C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=shred 99.0s|healing_touch 28.3s|rake 23.3s|ferocious_bite 14.2s|rip 9.4s|savage_roar 7.7s|thrash_cat 2.5s|waiting 116.9s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Kernoris 21318
cat_melee 5147 24.2% 355.3 0.85sec 4354 5145 Direct 355.3 3222 6442 4160 29.1% 55.2 966 1932 29.1%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 355.32 355.32 0.00 0.00 0.8463 0.0000 1546980.93 2377465.43 34.93 5144.58 5144.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.08 29.11% 1932.46 1280 2522 1933.43 1792 2242 31069 47748 34.93
multistrike 39.15 70.89% 966.31 640 1261 966.89 907 1071 37833 58143 34.93
hit 251.79 70.86% 3221.58 2134 4203 3223.50 3163 3297 811175 1246647 34.93
crit 103.52 29.14% 6442.08 4268 8406 6445.90 6207 6714 666904 1024927 34.93
 
DPS Timeline Chart
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
ferocious_bite 3563 16.6% 14.1 21.47sec 75360 75024 Direct 14.1 45512 91019 72003 58.2% 2.2 13624 27315 58.2%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.14 14.14 0.00 0.00 1.0045 0.0000 1065488.50 1637487.59 34.93 75023.83 75023.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.28 58.25% 27314.73 2617 36775 19937.61 0 36775 34970 53744 25.45
multistrike 0.92 41.75% 13624.02 985 18388 8248.78 0 18388 12504 19216 21.11
hit 5.91 41.79% 45512.01 3284 61292 45562.77 0 61292 268900 413257 34.90
crit 8.23 58.21% 91018.68 6561 122584 91190.47 64208 122584 749114 1151270 34.93
 
DPS Timeline Chart
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point{$?s67598=true}[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for $67598m1% of your total maximum health for each $67598m2 Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.]{$?s1079=true}[ When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target.][] Critical strike chance doubled against bleeding targets. 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
rake 3522 16.5% 23.2 13.07sec 45558 45355 Direct 23.2 6306 12610 8144 29.2% 3.6 1893 3781 29.1%  
Periodic 99.0 6427 12844 8297 29.1% 15.4 1973 3946 29.1% 98.7%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.23 23.23 98.97 98.97 1.0045 3.0000 1058266.11 1058266.11 0.00 3304.61 45354.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.05 29.13% 3780.93 2607 8654 2467.58 0 8654 3957 3957 0.00
multistrike 2.55 70.87% 1892.62 931 4327 1752.25 0 4327 4818 4818 0.00
hit 16.46 70.84% 6306.30 3103 14423 6322.08 5282 7763 103773 103773 0.00
crit 6.77 29.16% 12609.76 6206 28846 12636.00 0 28846 85414 85414 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.5 29.07% 3945.92 2607 8654 3905.40 0 8654 17653 17653 0.00
multistrike 10.9 70.93% 1972.98 931 4327 1976.07 0 3669 21536 21536 0.00
hit 70.1 70.86% 6427.13 2 14423 6437.62 5785 7205 450754 450754 0.00
crit 28.8 29.14% 12843.81 4 28846 12864.83 10395 16779 370361 370361 0.00
 
DPS Timeline Chart
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}. Awards {$s2=1} combo $lpoint:points;. If used while stealthed, the target will be stunned for {$163505d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
rip 4174 19.6% 9.3 24.98sec 134456 133867 Periodic 143.1 6500 12997 8394 29.2% 22.2 1950 3901 29.1% 95.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.35 9.35 143.09 143.09 1.0045 2.0000 1257011.41 1257011.41 0.00 4252.94 133867.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.5 29.10% 3900.75 2800 5347 3891.49 0 5347 25249 25249 0.00
multistrike 15.8 70.90% 1949.79 1400 2673 1948.76 1537 2374 30742 30742 0.00
hit 101.4 70.85% 6499.50 3550 8911 6496.12 5559 7052 658873 658873 0.00
crit 41.7 29.15% 12996.84 9017 17822 12990.62 10924 14640 542148 542148 0.00
 
DPS Timeline Chart
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<3&target.time_to_die-remains>18
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>)*8} damage 2 points: ${$floor(2*$<rip>)*8} damage 3 points: ${$floor(3*$<rip>)*8} damage 4 points: ${$floor(4*$<rip>)*8} damage 5 points: ${$floor(5*$<rip>)*8} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.086000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 569 2.7% 17.5 17.49sec 9797 0 Direct 17.5 2303 4607 2976 29.2% 2.7 691 1382 29.2%  
Periodic 98.2 1135 0 1135 0.0% 15.3 346 0 0.0% 32.6%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.47 17.47 98.18 98.18 0.0000 1.0000 171173.26 171173.26 0.00 1743.39 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.80 29.24% 1381.86 951 1531 757.03 0 1531 1103 1103 0.00
multistrike 1.93 70.76% 690.91 475 766 587.51 0 766 1335 1335 0.00
hit 12.37 70.79% 2303.27 1585 2552 2303.01 2161 2510 28486 28486 0.00
crit 5.10 29.21% 4606.95 3170 5103 4583.33 0 5103 23512 23512 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 15.3 100.00% 345.66 238 383 345.62 310 383 5276 5276 0.00
hit 98.2 100.00% 1135.23 0 1276 1135.61 1062 1239 111461 111461 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shred 4113 19.3% 98.6 3.05sec 12508 12452 Direct 98.6 9250 18505 11949 29.2% 15.4 2776 5553 29.1%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.58 98.58 0.00 0.00 1.0045 0.0000 1233066.65 1895028.75 34.93 12452.07 12452.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.48 29.15% 5552.61 3441 8812 5489.22 0 8812 24867 38217 34.51
multistrike 10.89 70.85% 2776.02 1721 4406 2778.62 0 3831 30218 46441 34.93
hit 69.83 70.84% 9250.17 5736 14686 9259.17 8784 9936 645967 992749 34.93
crit 28.75 29.16% 18505.43 11471 29373 18518.59 16961 20706 532014 817622 34.93
 
DPS Timeline Chart
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target{$?s48484=false}[ and reducing the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}][]. Awards {$s2=1} combo $lpoint:points;. Being stealthed increases damage by $5215m4% and doubles critical strike chance. Damage increased by {$106785s2=20}% against bleeding targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.00
 
thrash_cat 230 1.1% 2.5 60.91sec 28086 27967 Direct 2.5 4592 9186 5932 29.2% 0.4 1378 2749 29.6%  
Periodic 12.2 3282 6565 4240 29.2% 1.9 986 1968 29.0% 12.1%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.47 2.47 12.17 12.17 1.0045 3.0000 69357.75 69357.75 0.00 1779.32 27966.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.12 29.62% 2749.25 2053 3919 295.22 0 3919 319 319 0.00
multistrike 0.28 70.38% 1378.22 1026 1959 325.09 0 1959 379 379 0.00
hit 1.75 70.84% 4591.85 3422 6532 3871.18 0 6532 8032 8032 0.00
crit 0.72 29.16% 9185.68 6843 13063 4775.97 0 13063 6616 6616 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.6 28.99% 1968.01 1467 2800 781.27 0 2800 1089 1089 0.00
multistrike 1.4 71.01% 985.96 733 1400 656.53 0 1400 1336 1336 0.00
hit 8.6 70.81% 3281.80 2445 4667 3055.07 0 4667 28274 28274 0.00
crit 3.6 29.19% 6564.70 4889 9333 5795.29 0 9333 23313 23313 0.00
 
DPS Timeline Chart
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.omen_of_clarity.react&remains<4.5&active_enemies>1
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all enemy targets within $A2 yards, dealing $m1 bleed damage and an additional $o2 damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.315000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.225000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Kernoris
berserk 2.0 183.28sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.42 70.80% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.59 29.20% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
 
cat_form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.71 70.64% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.29 29.36% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:2368.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
healing_touch 29.2 10.52sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.18 29.18 0.00 0.00 0.9701 0.0000 0.00 955816.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.45 32.06% 0.00 0 0 0.00 0 0 0 20680 76.00
multistrike 3.07 67.94% 0.00 0 0 0.00 0 0 0 21907 95.66
hit 19.80 67.84% 0.00 0 0 0.00 0 0 0 468727 100.00
crit 9.38 32.16% 0.00 0 0 0.00 0 0 0 444503 100.00
 
HPS Timeline Chart
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3312.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}{$?s54825=false}[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}[ Healing increased by 50% when cast on self.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.600000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
leader_of_the_pack 40.0 7.60sec

Stats details: leader_of_the_pack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 40.03 40.03 0.00 0.00 0.0000 0.0000 0.00 329797.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.03 100.00% 0.00 0 0 0.00 0 0 0 329797 100.00
 
HPS Timeline Chart
 

Action details: leader_of_the_pack

Static Values
  • id:68285
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:
Spelldata
  • id:68285
  • name:Leader of the Pack
  • school:physical
  • tooltip:
  • description:{$@spelldesc17007=While in Bear Form or Cat Form, increases critical strike chance of all party and raid members within $24932a1 yards by {$24932s1=5}%. Also causes your melee critical strikes to heal you for {$68285s1=3}% of your health. This effect cannot occur more than once every 6 sec.}
 
savage_roar 7.7 37.66sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 7.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.savage_roar.remains<3
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
 
tigers_fury 10.2 30.54sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.23 10.23 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.26 70.93% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.97 29.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserk 2.0 0.0 183.3sec 183.3sec 10.15% 16.43% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserk_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106952
  • name:Berserk
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodtalons 29.2 0.0 10.4sec 10.5sec 38.00% 38.69% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodtalons_1:22.63%
  • bloodtalons_2:15.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=30}% additional damage.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=30}% additional damage.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 257.3sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
omen_of_clarity (omen_of_clarity) 20.4 0.4 14.2sec 13.9sec 4.05% 13.67% 0.4(0.4)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • omen_of_clarity_1:4.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Your next Cat Form ability has {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your autoattacks have a chance to reduce the Energy cost of your next Cat Form ability by {$16870s1=100}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
predatory_swiftness 28.8 0.8 10.4sec 10.1sec 61.66% 100.00% 0.8(0.8)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • predatory_swiftness_1:61.66%

Trigger Attempt Success

  • trigger_pct:95.32%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms, and heal for {$s4=20}% more.
  • description:{$@spelldesc16974=Your finishing moves have a $b3% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms, and to increase the healing done by Healing Touch by {$69369s4=20}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.13% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.$?$w2>=0[][ Movement speed slowed by $w2%.]
  • description:Activates Cat Form and places the Druid into stealth{$?s157274=false}[][, but reduces movement speed by {$s2=30}%]. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
tigers_fury 10.2 0.0 30.5sec 30.5sec 26.85% 28.78% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
cat_form

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • cat_form_1:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
savage_roar

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • savage_roar_1:99.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Snapshotting Details

Ability Tiger's Fury Bloodtalons
Name Execute % Benefit % Execute % Benefit %
ferocious_bite36.16 %36.16 % 86.24 %86.24 %
rake37.81 %48.24 % 81.89 %92.54 %
rip38.53 %39.72 % 85.12 %89.67 %
shred33.64 %33.64 % 16.62 %16.62 %
thrash_cat (_cat)23.60 %23.43 % 94.53 %94.68 %
Improved Rake
Execute %4.30 %
Benefit %4.50 %
Wasted Buffs0.00

Resources

Resource Usage Type Count Total Average RPE APR
Kernoris
ferocious_bite Energy 28.3 578.4 20.5 40.9 1842.1
rake Energy 23.2 684.6 29.5 29.5 1545.8
rip Energy 9.3 232.0 24.8 24.8 5418.5
savage_roar Energy 7.7 186.2 24.3 24.3 0.0
shred Energy 98.6 3111.7 31.6 31.6 396.3
Resource Gains Type Count Total Average Overflow
leader_of_the_pack Health 40.03 0.00 (0.00%) 0.00 329796.48 100.00%
yseras_gift Health 4.30 0.00 (0.00%) 0.00 46491.38 100.00%
healing_touch Health 33.70 0.00 (0.00%) 0.00 955807.26 100.00%
glyph_of_ferocious_bite Health 14.14 0.00 (0.00%) 0.00 272786.40 100.00%
energy_regen Energy 1027.11 3527.10 (64.38%) 3.43 25.56 0.72%
mp5_regen Mana 1027.11 0.00 (0.00%) 0.00 153902.87 100.00%
omen_of_clarity Energy 20.33 749.92 (13.69%) 36.89 0.00 0.00%
primal_fury Combo Points 35.52 35.52 (23.53%) 1.00 0.00 0.00%
rake Combo Points 23.23 19.89 (13.18%) 0.86 3.34 14.37%
shred Combo Points 98.58 95.55 (63.29%) 0.97 3.04 3.08%
soul_of_the_forest Energy 31.14 588.14 (10.73%) 18.89 5.19 0.88%
tigers_fury Energy 10.23 613.82 (11.20%) 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 15.71 15.93
Combo Points 0.50 0.49
Combat End Resource Mean Min Max
Mana 32000.00 32000.00 32000.00
Rage 0.00 0.00 0.00
Energy 21.41 0.01 100.00
Combo Points 2.60 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%

Procs

Count Interval
primal_fury 35.5 8.4sec

Statistics & Data Analysis

Fight Length
Sample Data Kernoris Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Kernoris Damage Per Second
Count 25000
Mean 21318.02
Minimum 18823.80
Maximum 24430.88
Spread ( max - min ) 5607.07
Range [ ( max - min ) / 2 * 100% ] 13.15%
Standard Deviation 738.7867
5th Percentile 20159.57
95th Percentile 22591.53
( 95th Percentile - 5th Percentile ) 2431.95
Mean Distribution
Standard Deviation 4.6725
95.00% Confidence Intervall ( 21308.86 - 21327.17 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4613
0.1 Scale Factor Error with Delta=300 4659
0.05 Scale Factor Error with Delta=300 18637
0.01 Scale Factor Error with Delta=300 465931
Distribution Chart
DPS(e)
Sample Data Kernoris Damage Per Second (Effective)
Count 25000
Mean 21318.02
Minimum 18823.80
Maximum 24430.88
Spread ( max - min ) 5607.07
Range [ ( max - min ) / 2 * 100% ] 13.15%
Damage
Sample Data Kernoris Damage
Count 25000
Mean 6401344.61
Minimum 4776863.22
Maximum 8287406.15
Spread ( max - min ) 3510542.93
Range [ ( max - min ) / 2 * 100% ] 27.42%
DTPS
Sample Data Kernoris Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kernoris Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Kernoris Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kernoris Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kernoris Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kernoris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data KernorisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Kernoris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 cat_form
9 0.00 wild_charge
A 0.00 displacer_beast,if=movement.distance>10
B 0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
C 1.00 rake,if=buff.prowl.up
D 1.00 auto_attack
E 0.00 skull_bash
F 0.00 force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
G 0.87 potion,name=draenic_agility,if=target.time_to_die<=40
H 0.00 blood_fury,sync=tigers_fury
I 0.00 berserking,sync=tigers_fury
J 0.00 arcane_torrent,sync=tigers_fury
K 10.23 tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
L 0.00 incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
M 0.13 potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
N 2.01 berserk,if=buff.tigers_fury.up
O 0.31 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Keep Rip from falling off during execute range.
P 28.18 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
Q 4.46 savage_roar,if=buff.savage_roar.remains<3
R 0.00 thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
S 0.00 thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
T 0.00 pool_resource,for_next=1
U 0.00 thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
V 0.00 call_action_list,name=finisher,if=combo_points=5
W 0.00 call_action_list,name=maintain
X 0.00 call_action_list,name=generator,if=combo_points<5
actions.finisher
# count action,conditions
Y 5.26 ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
Z 7.27 rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
a 2.08 rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
b 3.19 savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
c 8.57 ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)
actions.maintain
# count action,conditions
d 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
e 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
f 13.80 rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
g 2.47 thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
h 0.00 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
i 8.43 rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1
actions.generator
# count action,conditions
j 0.00 swipe,if=active_enemies>=3
k 98.58 shred,if=active_enemies<3

Sample Sequence

013457CDkkKNkkZkkkkPfckkkkPckkkPkZkfkKPbikkkPkZkkkPcfkKkPigbkkkPZkkkfPciKkkkPZikkkPbfkkkPKiZkkkkPcfkkPkZkKkkPfQkkkPfZkkPkcKNkkkPfckkkPkZkkkPfbkkkPgckkkKPfakkkkPkYkfkPibkkKkPiYkkkPkGYkkkPfgYkKkkkPfYkQkPki

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre healing_touch Kernoris 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 65.0/100: 65% energy | 1.0/5: 20% combo_points bloodtalons, draenic_agility_potion
0:01.004 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.8/100: 80% energy | 1.0/5: 20% combo_points bloodlust, bloodtalons, draenic_agility_potion
0:02.009 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.7/100: 55% energy | 2.0/5: 40% combo_points bloodlust, draenic_agility_potion
0:03.013 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.5/100: 29% energy | 3.0/5: 60% combo_points bloodlust, omen_of_clarity, draenic_agility_potion
0:03.013 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.5/100: 89% energy | 3.0/5: 60% combo_points bloodlust, omen_of_clarity, tigers_fury, draenic_agility_potion
0:03.013 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.5/150: 60% energy | 3.0/5: 60% combo_points bloodlust, berserk, omen_of_clarity, tigers_fury, draenic_agility_potion
0:04.017 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 104.3/150: 70% energy | 4.0/5: 80% combo_points bloodlust, berserk, tigers_fury, draenic_agility_potion
0:05.021 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.1/150: 66% energy | 5.0/5: 100% combo_points bloodlust, berserk, tigers_fury, draenic_agility_potion
0:06.025 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 119.0/150: 79% energy | 0.0/5: 0% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:07.028 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 113.8/150: 76% energy | 1.0/5: 20% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:08.033 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 108.6/150: 72% energy | 2.0/5: 40% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:09.037 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 103.4/150: 69% energy | 3.0/5: 60% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:10.040 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 98.3/150: 66% energy | 4.0/5: 80% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:11.045 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 113.1/150: 75% energy | 4.0/5: 80% combo_points bloodlust, berserk, bloodtalons(2), draenic_agility_potion
0:12.051 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 110.5/150: 74% energy | 5.0/5: 100% combo_points bloodlust, berserk, bloodtalons, draenic_agility_potion
0:13.056 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 120.3/150: 80% energy | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:14.060 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 115.1/150: 77% energy | 1.0/5: 20% combo_points bloodlust, berserk, omen_of_clarity, predatory_swiftness, draenic_agility_potion
0:15.065 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 130.0/150: 87% energy | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:16.070 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 124.8/150: 83% energy | 3.0/5: 60% combo_points bloodlust, berserk, omen_of_clarity, predatory_swiftness, draenic_agility_potion
0:17.074 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 139.6/150: 93% energy | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:18.079 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), draenic_agility_potion
0:19.084 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.8/100: 85% energy | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, draenic_agility_potion
0:20.086 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 59.6/100: 60% energy | 1.0/5: 20% combo_points bloodlust, predatory_swiftness
0:21.090 Waiting 0.400 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.5/100: 34% energy | 2.0/5: 40% combo_points bloodlust, predatory_swiftness
0:21.490 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.4/100: 40% energy | 2.0/5: 40% combo_points bloodlust, predatory_swiftness
0:22.494 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.2/100: 15% energy | 4.0/5: 80% combo_points bloodlust, predatory_swiftness
0:23.499 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.0/100: 30% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2)
0:24.199 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.4/100: 40% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2)
0:25.203 Waiting 1.063 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.2/100: 15% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons
0:26.266 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.9/100: 31% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons
0:27.272 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.7/100: 36% energy | 0.0/5: 0% combo_points bloodlust, predatory_swiftness
0:27.572 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.2/100: 40% energy | 0.0/5: 0% combo_points bloodlust, predatory_swiftness
0:28.578 Waiting 1.474 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.0/100: 15% energy | 2.0/5: 40% combo_points bloodlust, predatory_swiftness
0:30.052 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.8/100: 37% energy | 2.0/5: 40% combo_points bloodlust, predatory_swiftness
0:31.057 Waiting 1.666 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 16.6/100: 17% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:32.723 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.2/100: 41% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:33.728 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 16.1/100: 16% energy | 5.0/5: 100% combo_points bloodlust, predatory_swiftness
0:33.728 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 76.1/100: 76% energy | 5.0/5: 100% combo_points bloodlust, tigers_fury, predatory_swiftness
0:34.736 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 91.0/100: 91% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), tigers_fury
0:35.741 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), tigers_fury, predatory_swiftness
0:36.745 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.8/100: 80% energy | 1.0/5: 20% combo_points bloodlust, bloodtalons, tigers_fury, predatory_swiftness
0:37.749 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.7/100: 55% energy | 2.0/5: 40% combo_points bloodlust, tigers_fury, predatory_swiftness
0:38.754 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.5/100: 29% energy | 3.0/5: 60% combo_points bloodlust, tigers_fury, predatory_swiftness
0:39.554 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.3/100: 41% energy | 3.0/5: 60% combo_points bloodlust, tigers_fury, predatory_swiftness
0:40.562 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 16.2/100: 16% energy | 4.0/5: 80% combo_points bloodlust, tigers_fury, predatory_swiftness
0:41.567 Waiting 1.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.6/100: 28% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
0:42.667 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.1/100: 40% energy | 4.0/5: 80% combo_points bloodtalons(2)
0:43.672 Waiting 6.387 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
0:50.059 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.1/100: 84% energy | 5.0/5: 100% combo_points bloodtalons
0:51.063 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.5/100: 85% energy | 0.0/5: 0% combo_points predatory_swiftness
0:52.068 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.9/100: 57% energy | 2.0/5: 40% combo_points predatory_swiftness
0:53.073 Waiting 1.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.3/100: 28% energy | 3.0/5: 60% combo_points predatory_swiftness
0:54.173 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.8/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
0:55.178 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
0:56.183 Waiting 4.620 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.6/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:00.803 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 76.1/100: 76% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:01.808 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 57.5/100: 58% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:02.811 Waiting 0.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 33.9/100: 34% energy | 2.0/5: 40% combo_points predatory_swiftness
1:03.411 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
1:04.415 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.1/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
1:04.415 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.1/100: 72% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
1:05.420 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.5/100: 44% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
1:06.423 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.9/100: 55% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
1:07.427 Waiting 2.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.3/100: 31% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
1:09.527 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 55.2/100: 55% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, tigers_fury
1:10.531 Waiting 2.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.6/100: 67% energy | 5.0/5: 100% combo_points tigers_fury
1:12.531 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.3/100: 89% energy | 5.0/5: 100% combo_points
1:13.536 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.7/100: 96% energy | 0.0/5: 0% combo_points predatory_swiftness
1:14.541 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.2/100: 67% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
1:15.545 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 78.6/100: 79% energy | 3.0/5: 60% combo_points predatory_swiftness
1:16.548 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.0/100: 50% energy | 5.0/5: 100% combo_points predatory_swiftness
1:17.552 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 61.4/100: 61% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:18.557 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 62.8/100: 63% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:19.563 Waiting 0.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.2/100: 34% energy | 1.0/5: 20% combo_points predatory_swiftness
1:20.163 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.0/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
1:21.168 Waiting 2.506 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.4/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
1:23.674 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
1:24.679 Waiting 2.017 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
1:26.696 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 3.0/5: 60% combo_points predatory_swiftness
1:27.700 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
1:28.706 Waiting 2.771 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.1/100: 23% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:31.477 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.5/100: 55% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:32.482 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.9/100: 36% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:33.489 Waiting 1.110 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.4/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
1:34.599 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points predatory_swiftness
1:34.599 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
1:35.604 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.4/100: 56% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
1:36.607 Waiting 1.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.8/100: 28% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
1:37.707 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.3/100: 40% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
1:38.712 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.7/100: 12% energy | 5.0/5: 100% combo_points tigers_fury, predatory_swiftness
1:39.716 Waiting 0.666 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.1/100: 23% energy | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
1:40.382 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.7/100: 31% energy | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
1:41.387 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.1/100: 32% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
1:41.687 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.5/100: 36% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
1:42.692 Waiting 2.551 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
1:45.243 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
1:46.246 Waiting 1.319 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
1:47.565 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.3/100: 27% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
1:48.569 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.7/100: 39% energy | 3.0/5: 60% combo_points predatory_swiftness
1:48.769 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
1:49.774 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.4/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
1:50.778 Waiting 5.808 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.8/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:56.586 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.7/100: 90% energy | 5.0/5: 100% combo_points bloodtalons(2)
1:57.589 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 96.1/100: 96% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
1:58.593 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.5/100: 73% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
1:59.598 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.0/100: 44% energy | 2.0/5: 40% combo_points predatory_swiftness
2:00.604 Waiting 2.247 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.4/100: 15% energy | 3.0/5: 60% combo_points predatory_swiftness
2:02.851 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
2:03.856 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
2:04.858 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:04.858 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.7/100: 84% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
2:05.864 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 60.1/100: 60% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:06.870 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 61.6/100: 62% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
2:07.873 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.9/100: 33% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
2:08.573 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
2:09.580 Waiting 2.514 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:12.094 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:13.100 Waiting 2.516 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
2:15.616 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
2:16.620 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
2:17.624 Waiting 5.813 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2)
2:23.437 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.7/100: 90% energy | 5.0/5: 100% combo_points bloodtalons(2)
2:24.442 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.2/100: 71% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
2:25.445 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 47.5/100: 48% energy | 1.0/5: 20% combo_points predatory_swiftness
2:26.449 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 18.9/100: 19% energy | 3.0/5: 60% combo_points omen_of_clarity, predatory_swiftness
2:27.452 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.3/100: 30% energy | 4.0/5: 80% combo_points predatory_swiftness
2:28.456 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.7/100: 42% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:29.460 Waiting 1.543 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.2/100: 13% energy | 5.0/5: 100% combo_points bloodtalons
2:31.003 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.7/100: 31% energy | 5.0/5: 100% combo_points bloodtalons
2:32.009 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.1/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
2:32.709 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.1/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness
2:33.714 Waiting 1.190 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 11% energy | 1.0/5: 20% combo_points predatory_swiftness
2:34.904 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points predatory_swiftness
2:34.904 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
2:35.909 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.4/100: 56% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:36.914 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.8/100: 28% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
2:37.919 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.2/100: 39% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
2:38.922 Waiting 6.124 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.6/100: 16% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:45.046 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.2/100: 85% energy | 5.0/5: 100% combo_points bloodtalons
2:46.053 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 91.6/100: 92% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
2:47.060 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 63.1/100: 63% energy | 2.0/5: 40% combo_points predatory_swiftness
2:48.066 Waiting 0.500 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.5/100: 34% energy | 3.0/5: 60% combo_points predatory_swiftness
2:48.566 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.2/100: 40% energy | 3.0/5: 60% combo_points predatory_swiftness
2:49.569 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
2:50.575 Waiting 1.076 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.0/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:51.651 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:52.655 Waiting 1.677 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
2:54.332 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.7/100: 31% energy | 5.0/5: 100% combo_points bloodtalons
2:55.336 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.1/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
2:56.036 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.0/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness
2:57.040 Waiting 1.794 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.4/100: 11% energy | 2.0/5: 40% combo_points predatory_swiftness
2:58.834 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.8/100: 32% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
2:59.840 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.2/100: 43% energy | 4.0/5: 80% combo_points predatory_swiftness
3:00.846 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.7/100: 55% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:01.850 Waiting 2.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 5.0/5: 100% combo_points bloodtalons
3:04.050 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons
3:05.056 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
3:05.056 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.5/100: 92% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
3:05.056 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.5/150: 62% energy | 0.0/5: 0% combo_points berserk, tigers_fury, predatory_swiftness
3:06.063 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.9/150: 56% energy | 1.0/5: 20% combo_points berserk, tigers_fury, predatory_swiftness
3:07.068 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 75.3/150: 50% energy | 3.0/5: 60% combo_points berserk, tigers_fury, predatory_swiftness
3:08.072 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.7/150: 44% energy | 4.0/5: 80% combo_points berserk, tigers_fury, predatory_swiftness
3:09.077 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 78.2/150: 52% energy | 4.0/5: 80% combo_points berserk, bloodtalons(2), tigers_fury
3:10.082 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.1/150: 48% energy | 5.0/5: 100% combo_points berserk, bloodtalons, tigers_fury
3:11.089 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 78.5/150: 52% energy | 0.0/5: 0% combo_points berserk, tigers_fury, predatory_swiftness
3:12.094 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 69.9/150: 47% energy | 1.0/5: 20% combo_points berserk, tigers_fury, predatory_swiftness
3:13.098 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 61.3/150: 41% energy | 2.0/5: 40% combo_points berserk, omen_of_clarity, predatory_swiftness
3:14.102 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.7/150: 48% energy | 4.0/5: 80% combo_points berserk, predatory_swiftness
3:15.107 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.2/150: 56% energy | 4.0/5: 80% combo_points berserk, bloodtalons(2)
3:16.111 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 75.6/150: 50% energy | 5.0/5: 100% combo_points berserk, bloodtalons
3:17.117 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.0/150: 61% energy | 0.0/5: 0% combo_points berserk, predatory_swiftness
3:18.121 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.4/150: 56% energy | 1.0/5: 20% combo_points berserk, predatory_swiftness
3:19.127 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.8/150: 50% energy | 2.0/5: 40% combo_points berserk, predatory_swiftness
3:20.130 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.2/100: 66% energy | 4.0/5: 80% combo_points predatory_swiftness
3:21.135 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.6/100: 78% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:22.141 Waiting 3.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.0/100: 54% energy | 5.0/5: 100% combo_points bloodtalons
3:25.241 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.3/100: 89% energy | 5.0/5: 100% combo_points bloodtalons
3:26.245 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.7/100: 96% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:27.249 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.1/100: 67% energy | 2.0/5: 40% combo_points predatory_swiftness
3:28.253 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.5/100: 38% energy | 3.0/5: 60% combo_points omen_of_clarity, predatory_swiftness
3:29.258 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 49.9/100: 50% energy | 5.0/5: 100% combo_points omen_of_clarity, predatory_swiftness
3:30.262 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 61.3/100: 61% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons(2)
3:31.267 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.7/100: 73% energy | 5.0/5: 100% combo_points bloodtalons
3:32.067 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 81.8/100: 82% energy | 5.0/5: 100% combo_points bloodtalons
3:33.072 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 63.2/100: 63% energy | 0.0/5: 0% combo_points predatory_swiftness
3:34.077 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.6/100: 35% energy | 1.0/5: 20% combo_points omen_of_clarity, predatory_swiftness
3:35.081 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 46.0/100: 46% energy | 2.0/5: 40% combo_points predatory_swiftness
3:36.085 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 17.4/100: 17% energy | 4.0/5: 80% combo_points predatory_swiftness
3:36.085 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.4/100: 77% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
3:37.090 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 88.9/100: 89% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
3:38.095 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 65.3/100: 65% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
3:39.098 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.7/100: 67% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
3:40.103 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.1/100: 38% energy | 1.0/5: 20% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
3:41.107 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 49.5/100: 49% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
3:42.112 Waiting 1.761 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 20.9/100: 21% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:43.873 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:44.877 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
3:45.880 Waiting 1.514 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:47.394 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:48.398 Waiting 3.418 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
3:51.816 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons
3:52.821 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points predatory_swiftness
3:53.521 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness
3:54.524 Waiting 2.054 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
3:56.578 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 1.0/5: 20% combo_points predatory_swiftness
3:57.584 Waiting 2.575 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
4:00.159 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
4:01.163 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
4:02.168 Waiting 1.013 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:03.181 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:04.185 Waiting 1.277 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
4:05.462 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 5.0/5: 100% combo_points bloodtalons
4:06.466 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points omen_of_clarity, bloodtalons, predatory_swiftness
4:07.470 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.9/100: 44% energy | 1.0/5: 20% combo_points predatory_swiftness
4:08.474 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.3/100: 15% energy | 3.0/5: 60% combo_points predatory_swiftness
4:08.474 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 75.3/100: 75% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
4:09.477 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 46.7/100: 47% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
4:10.482 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 58.1/100: 58% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
4:11.486 Waiting 1.400 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.6/100: 35% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
4:12.886 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.5/100: 50% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
4:13.889 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.8/100: 32% energy | 0.0/5: 0% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
4:14.892 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.2/100: 43% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
4:15.897 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 14.7/100: 15% energy | 2.0/5: 40% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
4:16.899 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.0/100: 26% energy | 4.0/5: 80% combo_points predatory_swiftness
4:17.904 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.5/100: 37% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:18.204 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:19.209 Waiting 1.119 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
4:20.328 potion Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 5.0/5: 100% combo_points bloodtalons
4:20.328 Waiting 2.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:22.628 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:23.631 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:24.331 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:25.333 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.8/100: 12% energy | 1.0/5: 20% combo_points omen_of_clarity, predatory_swiftness, draenic_agility_potion
4:26.338 Waiting 1.553 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:27.891 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:28.897 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness, draenic_agility_potion
4:29.899 Waiting 1.013 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2), draenic_agility_potion
4:30.912 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2), draenic_agility_potion
4:31.918 Waiting 1.176 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:33.094 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, draenic_agility_potion
4:34.101 Waiting 1.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.4/100: 36% energy | 5.0/5: 100% combo_points draenic_agility_potion
4:35.301 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.1/100: 50% energy | 5.0/5: 100% combo_points draenic_agility_potion
4:36.305 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.5/100: 31% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:37.105 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.6/100: 41% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:38.108 Waiting 1.148 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness, draenic_agility_potion
4:39.256 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points predatory_swiftness, draenic_agility_potion
4:39.256 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:40.260 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.4/100: 56% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:41.264 Waiting 1.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.8/100: 28% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:42.364 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.3/100: 40% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:43.366 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.7/100: 12% energy | 4.0/5: 80% combo_points omen_of_clarity, tigers_fury, predatory_swiftness, draenic_agility_potion
4:44.370 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.1/100: 23% energy | 4.0/5: 80% combo_points omen_of_clarity, bloodtalons(2), tigers_fury, draenic_agility_potion
4:45.373 Waiting 1.400 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.5/100: 34% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
4:46.773 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.4/100: 50% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
4:47.776 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.8/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
4:48.576 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 0.0/5: 0% combo_points predatory_swiftness
4:49.579 Waiting 1.422 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
4:51.001 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.4/100: 28% energy | 1.0/5: 20% combo_points predatory_swiftness
4:52.007 Waiting 1.943 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 18.8/100: 19% energy | 0.0/5: 0% combo_points predatory_swiftness
4:53.950 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 0.0/5: 0% combo_points predatory_swiftness
4:54.956 Waiting 2.415 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
4:57.371 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.8/100: 40% energy | 1.0/5: 20% combo_points predatory_swiftness
4:58.377 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.2/100: 51% energy | 1.0/5: 20% combo_points bloodtalons(2)
4:59.381 Waiting 1.612 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 22.6/100: 23% energy | 2.0/5: 40% combo_points bloodtalons
5:00.993 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points bloodtalons

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 660 629 629
Agility 3981 3529 3426 (1204)
Stamina 3814 3468 3468
Intellect 1089 1038 1038
Spirit 781 781 781
Health 228840 208080 0
Mana 32000 32000 0
Rage 100 100 0
Energy 100 100 0
Combo Points 5 5 0
Crit 32.15% 26.19% 1121
Haste 13.59% 8.18% 818
Multistrike 7.77% 2.77% 183
Damage / Heal Versatility 5.66% 2.66% 346
ManaReg per Second 512 512 0
Attack Power 4379 3529 0
Mastery 49.61% 33.96% 313
Armor 816 816 816
Run Speed 0 0 95

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Feral Druid) Mass Entanglement Typhoon
60 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Force of Nature (Feral Druid)
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild (Feral Druid) Dream of Cenarius (Feral Druid) Nature's Vigil
100 Lunar Inspiration (Feral Druid) Bloodtalons (Feral Druid) Claws of Shirvallah (Feral Druid)

Profile

druid="Kernoris"
origin="http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/20/55011348-avatar.jpg"
level=100
race=worgen
role=attack
position=back
professions=alchemy=700/herbalism=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#UZ!2020211
glyphs=savage_roar/cat_form/ferocious_bite/grace/travel/aquatic_form
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
actions+=/potion,name=draenic_agility,if=target.time_to_die<=40
actions+=/blood_fury,sync=tigers_fury
actions+=/berserking,sync=tigers_fury
actions+=/arcane_torrent,sync=tigers_fury
actions+=/tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
actions+=/incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
actions+=/potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
actions+=/berserk,if=buff.tigers_fury.up
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
actions+=/savage_roar,if=buff.savage_roar.remains<3
actions+=/thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
actions+=/thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions+=/pool_resource,for_next=1
actions+=/thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
actions+=/call_action_list,name=finisher,if=combo_points=5
actions+=/call_action_list,name=maintain
actions+=/call_action_list,name=generator,if=combo_points<5

actions.finisher=ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
actions.finisher+=/rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
actions.finisher+=/rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
actions.finisher+=/savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
actions.finisher+=/ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)

actions.maintain=rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions.maintain+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
actions.maintain+=/rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1

actions.generator=swipe,if=active_enemies>=3
actions.generator+=/shred,if=active_enemies<3

head=crown_of_woe,id=118941
neck=mordant_gorget,id=119011,bonus_id=202/560,enchant=40crit
shoulders=bloodfeather_spaulders,id=109935,bonus_id=524
back=rotmelter_mosscloak,id=116294
chest=crystalbinder_chestguard,id=109886,bonus_id=42/524
shirt=undisputed_champions_shirt,id=98082
wrists=bloodfeather_bracers,id=109869,bonus_id=524
hands=bloodfeather_grips,id=109849,bonus_id=522
waist=springrain_belt,id=119513
legs=legguards_of_burning_focus,id=109809,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=30
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
finger2=ceds_chiming_circle,id=109760,bonus_id=523/524,gems=35crit,enchant=30crit
trinket1=bloodmaws_tooth,id=116289
trinket2=grandiose_plans,id=114549
main_hand=chasmwrench_docking_hook,id=110059,bonus_id=524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_agility=2076
# gear_stamina=2578
# gear_crit_rating=1068
# gear_haste_rating=818
# gear_mastery_rating=313
# gear_armor=816
# gear_multistrike_rating=183
# gear_versatility_rating=346
# gear_speed_rating=95

Rapáx

Rapáx : 23840 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23839.8 23839.8 4.8 / 0.020% 1505.5 / 6.3% 1770.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.0 12.0 Focus 0.00% 46.8 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Spirit Bond
  • 60: Thrill of the Hunt
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Focusing Shot (Survival Hunter)
  • Talent Calculator
Glyphs
  • Glyph of Liberation
  • Glyph of Deterrence
  • Glyph of Animal Bond
  • Glyph of Aspect of the Pack
  • Glyph of Aspect of the Cheetah
  • Glyph of Tame Beast
Professions
  • leatherworking: 700
  • skinning: 700

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:89985|61996|21194|19167|11307|4105|2149&chds=0,179970&chco=C79C6E,9482C9,C79C6E,C41F3B,69CCF0,C79C6E,C79C6E&chm=t++89985++a_murder_of_crows,C79C6E,0,0,15|t++61996++black_arrow,9482C9,1,0,15|t++21194++barrage,C79C6E,2,0,15|t++19167++explosive_shot,C41F3B,3,0,15|t++11307++arcane_shot,69CCF0,4,0,15|t++4105++focusing_shot,C79C6E,5,0,15|t++2149++auto_shot,C79C6E,6,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:22,18,16,12,10,9,8,7,6,3&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,69CCF0,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=explosive_shot|serpent_sting|arcane_shot|black_arrow|barrage|auto_shot|cat: melee|crow_peck|focusing_shot|cat: claw&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:aehlosvy14577753211zvutqqonllklkkkkklllkljjjiihgggfffefffgghhijkkkllllllllkkkjkkjkjijiiiiiiihiighhfgffgffggfggghhhiiiijjkkklmmnooqqqsstuvvvvuvuttsqqonmlkkjihhghhghhhhhhhhhhhggggggfgggggghhhjjjkkkllkllkklkkkjjjiiiiiihiihiihhhhhhgggggggggghhhiiijjjkkkklllllmmmmnmnnnonnnnnmmmllkjjiiihhhggggggghgghhhhhhhhgghgghgggghhhiijkjkklllllllkkkjjkijiiiihiiihhihhhhihhhghgfgfeecbZXWUTRQO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.618108,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=23840|max=38569&chxp=1,1,62,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,0,2,3,5,9,27,35,69,110,159,224,320,459,618,786,939,1071,1226,1359,1477,1556,1532,1541,1454,1406,1371,1258,1076,969,818,706,533,474,359,276,239,163,114,85,62,39,24,16,10,5,9,1,1,2&chds=0,1556&chbh=5&chxt=x&chxl=0:|min=22402|avg=23840|max=25451&chxp=0,1,47,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:30.1,29.3,24.7,10.1,4.1,1.7&chds=0,100&chdls=ffffff&chco=C79C6E,69CCF0,C41F3B,C79C6E,9482C9,C79C6E&chl=focusing_shot 90.6s|arcane_shot 88.1s|explosive_shot 74.3s|barrage 30.5s|black_arrow 12.3s|a_murder_of_crows 5.2s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rapáx 23840
a_murder_of_crows 0 (1567) 0.0% (6.6%) 5.2 63.33sec 90383 89985

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.21 5.21 76.26 76.26 1.0045 1.0000 0.00 0.00 0.00 5778.37 89984.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.3 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1567 6.6% 0.0 0.00sec 0 0 Direct 76.3 4118 8425 5791 38.9% 16.8 1235 2528 38.8%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 76.26 0.00 0.00 0.0000 0.0000 470891.13 723685.31 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.54 38.83% 2528.28 2275 2854 2527.15 0 2854 16531 25405 34.86
multistrike 10.30 61.17% 1235.41 1138 1427 1236.91 1138 1427 12724 19554 34.93
hit 46.63 61.15% 4117.69 3792 4756 4123.00 3814 4412 192009 295087 34.93
crit 29.63 38.85% 8425.26 7584 9513 8438.64 7672 9272 249628 383639 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 3313 13.9% 87.7 3.40sec 11358 11307 Direct 87.3 7737 15616 10564 35.9% 19.3 2785 5622 35.8%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.67 87.32 0.00 0.00 1.0045 0.0000 995813.86 995813.86 0.00 11307.33 11307.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.91 35.83% 5621.57 5429 6493 5617.48 0 6493 38856 38856 0.00
multistrike 12.38 64.17% 2785.00 2715 3246 2786.27 2715 3246 34482 34482 0.00
hit 56.00 64.13% 7737.35 7540 9018 7740.78 7540 8064 433266 433266 0.00
crit 31.33 35.87% 15616.45 15081 18036 15626.00 15081 16645 489210 489210 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 1909 8.0% 106.4 2.84sec 5392 2149 Direct 106.4 3652 7380 4995 36.0% 23.5 1315 2656 36.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.38 106.38 0.00 0.00 2.5096 0.0000 573620.07 881563.48 34.93 2148.69 2148.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.46 35.97% 2656.11 2556 3065 2656.98 0 3065 22473 34538 34.92
multistrike 15.06 64.03% 1314.87 1278 1532 1315.46 1278 1476 19802 30433 34.93
hit 68.06 63.98% 3652.44 3550 4256 3654.05 3567 3775 248589 382041 34.93
crit 38.32 36.02% 7379.50 7100 8513 7384.36 7100 7806 282756 434552 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2151 9.0% 11.0 27.21sec 58642 21194 Periodic 176.1 2389 4836 3271 36.1% 39.1 1322 2675 36.1% 9.2%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.03 176.46 176.08 2.7670 0.1574 646738.91 955976.91 32.35 21194.13 21194.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.1 36.11% 2675.24 2569 3072 2677.08 2569 3072 37724 37724 0.00
multistrike 25.0 63.89% 1321.75 1285 1536 1322.47 1285 1473 32984 32984 0.00
hit 112.6 63.93% 2388.62 2322 2777 2389.87 2322 2487 268866 413204 34.93
crit 63.5 36.07% 4835.64 4643 5553 4838.94 4643 5109 307166 472066 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 2528 10.6% 12.2 25.79sec 62271 61996 Periodic 117.3 4381 8876 6000 36.0% 25.9 1577 3196 36.0% 78.0%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.21 12.17 117.35 117.35 1.0045 2.0000 760132.95 760132.95 0.00 3077.97 61996.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.91 64.99% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.26 35.01% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.3 36.02% 3196.02 3046 3821 3198.50 0 3821 29872 29872 0.00
multistrike 16.6 63.98% 1577.11 1523 1910 1578.08 1523 1805 26178 26178 0.00
hit 75.1 63.98% 4380.68 4231 5307 4383.23 4268 4558 328911 328911 0.00
crit 42.3 36.02% 8876.30 8462 10613 8883.60 8508 9455 375171 375171 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
explosive_shot 4733 19.9% 73.9 4.07sec 19253 19167 Direct 73.7 3287 6655 4498 36.0% 16.3 1183 2395 36.0%  
Periodic 169.0 4262 8626 5837 36.1% 37.5 1534 3105 36.1% 56.2%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.92 73.69 169.03 169.03 1.0045 1.0000 1423193.95 1423193.95 0.00 5849.93 19167.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.88 35.98% 2395.10 2285 2866 2389.37 0 2866 14082 14082 0.00
multistrike 10.46 64.02% 1183.34 1142 1433 1183.77 0 1433 12378 12378 0.00
hit 47.19 64.04% 3286.72 3173 3980 3288.65 3173 3467 155101 155101 0.00
crit 26.50 35.96% 6655.08 6347 7960 6660.18 6347 7220 176328 176328 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.5 36.07% 3104.99 2285 8094 3106.05 2285 4963 41954 41954 0.00
multistrike 23.9 63.93% 1533.92 1142 3964 1534.15 1174 2186 36728 36728 0.00
hit 108.0 63.91% 4261.94 3173 11417 4261.96 3787 5087 460423 460423 0.00
crit 61.0 36.09% 8626.19 6347 22835 8627.87 7358 11037 526201 526201 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
focusing_shot 1236 5.2% 42.5 6.98sec 8739 4105 Direct 42.5 5939 11979 8101 35.8% 9.4 2138 4313 35.8%  

Stats details: focusing_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.55 42.52 0.00 0.00 2.1290 0.0000 371804.85 571405.35 34.93 4104.67 4104.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.36 35.78% 4312.60 4179 4998 4166.57 0 4998 14493 22274 33.74
multistrike 6.03 64.22% 2137.57 2090 2499 2133.19 0 2499 12891 19812 34.85
hit 27.30 64.21% 5939.29 5804 6942 5941.35 5804 6273 162136 249178 34.93
crit 15.22 35.79% 11978.80 11608 13883 11986.07 11608 12973 182284 280141 34.93
 
DPS Timeline Chart
 

Action details: focusing_shot

Static Values
  • id:152245
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:180.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152245
  • name:Focusing Shot
  • school:physical
  • tooltip:
  • description:Carefully line up a shot at the target that deals $sw1 Physical damage and focuses you, generating {$s2=50} Focus. Cannot be cast while moving. Replaces Steady Shot and Cobra Shot.$?s53224[ Also triggers Steady Focus.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
serpent_sting 3909 16.4% 87.3 3.40sec 13462 0 Periodic 185.7 4293 8681 5865 35.8% 41.1 1546 3125 35.8% 98.0%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.32 87.32 185.67 185.67 0.0000 1.5891 1175570.80 1175570.80 0.00 3984.27 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.91 64.03% 0.00 0 0 0.00 0 0 0 0 0.00
crit 31.41 35.97% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.7 35.76% 3125.47 2998 3761 3127.30 2998 3608 45897 45897 0.00
multistrike 26.4 64.24% 1545.63 1499 1880 1546.44 1499 1701 40770 40770 0.00
hit 119.2 64.18% 4292.68 12 5223 4294.95 4198 4429 511538 511538 0.00
crit 66.5 35.82% 8680.95 19 10447 8687.14 8361 9094 577365 577365 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - cat 2494 / 2494
claw 729 3.1% 72.7 4.18sec 3007 2994 Direct 72.7 1905 3886 2820 46.2% 16.1 572 1166 46.2%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.74 72.74 0.00 0.00 1.0045 0.0000 218744.26 336175.39 34.93 2993.79 2993.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.43 46.25% 1165.68 1069 2683 1166.63 0 2683 8662 13312 34.90
multistrike 8.64 53.75% 571.95 535 1341 572.42 0 1341 4939 7591 34.93
hit 39.13 53.80% 1905.06 1782 4471 1906.84 1782 2142 74555 114579 34.93
crit 33.60 46.20% 3886.04 3565 8942 3891.28 3565 4520 130588 200694 34.93
 
DPS Timeline Chart
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 1766 7.4% 195.9 1.53sec 2709 1768 Direct 195.9 1725 3493 2540 46.1% 43.4 518 1048 46.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.92 195.92 0.00 0.00 1.5320 0.0000 530664.31 815547.26 34.93 1767.97 1767.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.99 46.10% 1047.75 1000 1254 1048.45 1000 1175 20943 32185 34.93
multistrike 23.37 53.90% 517.61 500 627 517.91 500 574 12098 18592 34.93
hit 105.62 53.91% 1725.08 1667 2090 1726.03 1686 1782 182211 280029 34.93
crit 90.30 46.09% 3493.05 3333 4181 3495.62 3387 3654 315413 484740 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Rapáx
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_pet

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 154.8sec 0.0sec 15.17% 15.19% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.5 0.2 20.5sec 20.2sec 7.96% 39.15% 0.2(0.2)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:4.86%
  • lock_and_load_2:3.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
megawatt_filament 7.2 2.4 43.9sec 31.6sec 32.79% 32.80% 2.4(2.4)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_megawatt_filament
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:750.00

Stack Uptimes

  • megawatt_filament_1:32.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156060
  • name:Megawatt Filament
  • tooltip:Critical strike increased by $w1.
  • description:Critical strike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.0 0.0 120.3sec 120.3sec 19.15% 19.16% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
thrill_of_the_hunt 16.4 4.4 18.1sec 14.1sec 30.80% 60.99% 4.4(8.3)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • thrill_of_the_hunt_1:10.71%
  • thrill_of_the_hunt_2:11.24%
  • thrill_of_the_hunt_3:8.85%

Trigger Attempt Success

  • trigger_pct:13.33%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rapáx
a_murder_of_crows Focus 5.2 156.3 30.0 30.0 3012.8
arcane_shot Focus 87.7 1705.7 19.5 19.5 583.8
barrage Focus 11.0 661.7 60.0 60.0 977.4
black_arrow Focus 12.2 427.2 35.0 35.0 1779.2
explosive_shot Focus 73.9 673.1 9.1 9.1 2114.3
pet - cat
claw Focus 72.7 1868.5 25.7 25.7 117.1
Resource Gains Type Count Total Average Overflow
focus_regen Focus 231.91 1424.00 (30.79%) 6.14 0.27 0.02%
external_healing Health 8.84 0.00 (0.00%) 0.00 82127.46 100.00%
thrill_of_the_hunt_savings Focus 53.70 1074.05 (23.22%) 20.00 0.00 0.00%
focusing_shot Focus 42.55 2127.32 (45.99%) 50.00 0.00 0.00%
pet - cat
focus_regen Focus 300.46 1780.96 (100.00%) 5.93 0.00 0.00%
Resource RPS-Gain RPS-Loss
Focus 11.80 12.04
Combat End Resource Mean Min Max
Focus 27.37 0.02 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.0%
cat-Focus Cap 0.0%
devilsaur-Focus Cap 0.0%
raptor-Focus Cap 0.0%
hyena-Focus Cap 0.0%
wolf-Focus Cap 0.0%
wasp-Focus Cap 0.0%
t17_pet_2-Focus Cap 0.0%
t17_pet_1-Focus Cap 0.0%
dire_beast_1-Focus Cap 0.0%
dire_beast_2-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%
tier15_thunderhawk-Focus Cap 0.0%

Procs

Count Interval
starved: black_arrow 6.2 31.1sec
starved: explosive_shot 4.0 48.5sec
starved: a_murder_of_crows 3.2 36.8sec
starved: barrage 27.1 10.7sec
thrill_of_the_hunt 20.8 14.1sec
lock_and_load 14.7 20.2sec

Statistics & Data Analysis

Fight Length
Sample Data Rapáx Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Rapáx Damage Per Second
Count 25000
Mean 23839.82
Minimum 22401.89
Maximum 25450.83
Spread ( max - min ) 3048.94
Range [ ( max - min ) / 2 * 100% ] 6.39%
Standard Deviation 385.9179
5th Percentile 23235.17
95th Percentile 24499.45
( 95th Percentile - 5th Percentile ) 1264.27
Mean Distribution
Standard Deviation 2.4408
95.00% Confidence Intervall ( 23835.04 - 23844.60 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1006
0.1 Scale Factor Error with Delta=300 1271
0.05 Scale Factor Error with Delta=300 5085
0.01 Scale Factor Error with Delta=300 127137
Distribution Chart
DPS(e)
Sample Data Rapáx Damage Per Second (Effective)
Count 25000
Mean 23839.82
Minimum 22401.89
Maximum 25450.83
Spread ( max - min ) 3048.94
Range [ ( max - min ) / 2 * 100% ] 6.39%
Damage
Sample Data Rapáx Damage
Count 25000
Mean 6417766.52
Minimum 4842271.44
Maximum 8079849.71
Spread ( max - min ) 3237578.28
Range [ ( max - min ) / 2 * 100% ] 25.22%
DTPS
Sample Data Rapáx Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rapáx Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rapáx Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rapáx Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rapáx Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rapáx Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RapáxTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rapáx Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 arcane_torrent,if=focus.deficit>=30
9 0.00 blood_fury
A 0.00 berserking
B 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
C 0.00 call_action_list,name=aoe,if=active_enemies>1
D 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
E 12.21 black_arrow,if=!ticking
F 73.92 explosive_shot
G 5.21 a_murder_of_crows
H 0.00 dire_beast
I 20.86 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
J 0.00 glaive_toss
K 0.00 powershot
L 11.03 barrage
M 0.00 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
N 66.82 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
O 42.87 focusing_shot
P 0.00 cobra_shot

Sample Sequence

01267EFGINNOFLFFFNOIINFONIENFNNOILFONNOFNNOFFFEIIINOFNNOFFFGNOLFFEOFNNONFONNNOFIIIFFFEOLFONNOFFFNNNOFNNNBOEFGNNOFIFFFFFNNOLFOEINFNONNFOFFFLOFNNOEFNONIFNFFFOGLOFNIIENNFFFFFNFFFOLFNOIIFENOIFIFFFINNOFINOLFNOEGOFIIFFFIIINOFNOLFNOEIFNNONFNNOLFFFFO

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.005 explosive_shot Fluffy_Pillow 71.0/100: 71% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:02.010 a_murder_of_crows Fluffy_Pillow 61.9/100: 62% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:03.014 arcane_shot Fluffy_Pillow 37.9/100: 38% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:04.020 arcane_shot Fluffy_Pillow 33.8/100: 34% focus bloodlust, thrill_of_the_hunt(2), megawatt_filament, draenic_agility_potion
0:05.025 arcane_shot Fluffy_Pillow 29.8/100: 30% focus bloodlust, thrill_of_the_hunt, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:06.028 focusing_shot Fluffy_Pillow 25.7/100: 26% focus bloodlust, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:07.720 explosive_shot Fluffy_Pillow 85.8/100: 86% focus bloodlust, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:08.726 barrage Fluffy_Pillow 76.7/100: 77% focus bloodlust, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:10.969 explosive_shot Fluffy_Pillow 30.0/100: 30% focus bloodlust, lock_and_load(2), spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:11.971 explosive_shot Fluffy_Pillow 36.0/100: 36% focus bloodlust, lock_and_load, spirit_of_the_warlords, megawatt_filament, draenic_agility_potion
0:12.977 explosive_shot Fluffy_Pillow 41.9/100: 42% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:13.981 arcane_shot Fluffy_Pillow 32.9/100: 33% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:14.986 focusing_shot Fluffy_Pillow 8.8/100: 9% focus bloodlust, thrill_of_the_hunt(2), spirit_of_the_warlords, draenic_agility_potion
0:16.679 arcane_shot Fluffy_Pillow 68.9/100: 69% focus bloodlust, thrill_of_the_hunt(2), spirit_of_the_warlords, draenic_agility_potion
0:17.683 arcane_shot Fluffy_Pillow 64.8/100: 65% focus bloodlust, thrill_of_the_hunt, spirit_of_the_warlords, draenic_agility_potion
0:18.687 arcane_shot Fluffy_Pillow 60.8/100: 61% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:19.690 explosive_shot Fluffy_Pillow 36.7/100: 37% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:20.694 focusing_shot Fluffy_Pillow 27.7/100: 28% focus bloodlust, spirit_of_the_warlords
0:22.384 arcane_shot Fluffy_Pillow 87.7/100: 88% focus bloodlust, spirit_of_the_warlords
0:23.388 arcane_shot Fluffy_Pillow 63.6/100: 64% focus bloodlust, thrill_of_the_hunt(2), spirit_of_the_warlords
0:24.393 black_arrow Fluffy_Pillow 59.6/100: 60% focus bloodlust, thrill_of_the_hunt
0:25.397 arcane_shot Fluffy_Pillow 30.5/100: 31% focus bloodlust, thrill_of_the_hunt(3)
0:26.401 explosive_shot Fluffy_Pillow 26.5/100: 26% focus bloodlust, thrill_of_the_hunt(2)
0:27.404 arcane_shot Fluffy_Pillow 17.4/100: 17% focus bloodlust, thrill_of_the_hunt(3)
0:28.407 arcane_shot Fluffy_Pillow 13.4/100: 13% focus bloodlust, thrill_of_the_hunt(2)
0:29.412 focusing_shot Fluffy_Pillow 9.3/100: 9% focus bloodlust, thrill_of_the_hunt
0:31.104 arcane_shot Fluffy_Pillow 69.4/100: 69% focus bloodlust, thrill_of_the_hunt
0:32.108 barrage Fluffy_Pillow 65.3/100: 65% focus bloodlust
0:34.486 explosive_shot Fluffy_Pillow 19.4/100: 19% focus bloodlust
0:35.492 focusing_shot Fluffy_Pillow 10.4/100: 10% focus bloodlust
0:37.183 arcane_shot Fluffy_Pillow 70.4/100: 70% focus bloodlust
0:38.187 arcane_shot Fluffy_Pillow 46.4/100: 46% focus bloodlust
0:39.192 focusing_shot Fluffy_Pillow 22.3/100: 22% focus bloodlust
0:40.883 explosive_shot Fluffy_Pillow 82.3/100: 82% focus bloodlust
0:41.886 arcane_shot Fluffy_Pillow 71.9/100: 72% focus
0:42.889 arcane_shot Fluffy_Pillow 46.5/100: 46% focus
0:43.892 focusing_shot Fluffy_Pillow 21.1/100: 21% focus
0:46.089 explosive_shot Fluffy_Pillow 81.1/100: 81% focus lock_and_load(2), megawatt_filament
0:47.094 explosive_shot Fluffy_Pillow 85.7/100: 86% focus lock_and_load, megawatt_filament
0:48.098 explosive_shot Fluffy_Pillow 90.2/100: 90% focus megawatt_filament
0:49.102 black_arrow Fluffy_Pillow 79.8/100: 80% focus megawatt_filament
0:50.107 arcane_shot Fluffy_Pillow 49.4/100: 49% focus thrill_of_the_hunt(3), megawatt_filament
0:51.113 arcane_shot Fluffy_Pillow 44.0/100: 44% focus thrill_of_the_hunt(2), megawatt_filament
0:52.118 arcane_shot Fluffy_Pillow 38.6/100: 39% focus thrill_of_the_hunt, megawatt_filament
0:53.122 arcane_shot Fluffy_Pillow 33.1/100: 33% focus megawatt_filament
0:54.126 focusing_shot Fluffy_Pillow 7.7/100: 8% focus megawatt_filament
0:56.324 explosive_shot Fluffy_Pillow 67.7/100: 68% focus megawatt_filament
0:57.328 arcane_shot Fluffy_Pillow 57.3/100: 57% focus megawatt_filament
0:58.332 arcane_shot Fluffy_Pillow 31.9/100: 32% focus
0:59.335 focusing_shot Fluffy_Pillow 6.5/100: 6% focus
1:01.532 explosive_shot Fluffy_Pillow 66.5/100: 66% focus lock_and_load(2)
1:02.535 explosive_shot Fluffy_Pillow 71.1/100: 71% focus lock_and_load
1:03.539 explosive_shot Fluffy_Pillow 75.6/100: 76% focus
1:04.544 a_murder_of_crows Fluffy_Pillow 65.2/100: 65% focus
1:05.549 arcane_shot Fluffy_Pillow 39.8/100: 40% focus
1:06.553 focusing_shot Fluffy_Pillow 14.4/100: 14% focus
1:08.749 barrage Fluffy_Pillow 74.4/100: 74% focus
1:11.603 explosive_shot Fluffy_Pillow 27.4/100: 27% focus lock_and_load(2)
1:12.607 explosive_shot Fluffy_Pillow 32.0/100: 32% focus lock_and_load
1:13.612 black_arrow Fluffy_Pillow 36.6/100: 37% focus
1:14.616 focusing_shot Fluffy_Pillow 6.2/100: 6% focus
1:16.814 explosive_shot Fluffy_Pillow 66.2/100: 66% focus
1:17.818 arcane_shot Fluffy_Pillow 55.8/100: 56% focus
1:18.823 arcane_shot Fluffy_Pillow 30.3/100: 30% focus
1:19.825 focusing_shot Fluffy_Pillow 4.9/100: 5% focus
1:22.024 arcane_shot Fluffy_Pillow 64.9/100: 65% focus megawatt_filament
1:23.028 explosive_shot Fluffy_Pillow 39.5/100: 40% focus megawatt_filament
1:24.032 focusing_shot Fluffy_Pillow 29.1/100: 29% focus megawatt_filament
1:26.230 arcane_shot Fluffy_Pillow 89.1/100: 89% focus megawatt_filament
1:27.236 arcane_shot Fluffy_Pillow 63.7/100: 64% focus megawatt_filament
1:28.242 arcane_shot Fluffy_Pillow 38.3/100: 38% focus megawatt_filament
1:29.246 focusing_shot Fluffy_Pillow 12.9/100: 13% focus megawatt_filament
1:31.445 explosive_shot Fluffy_Pillow 72.9/100: 73% focus megawatt_filament
1:32.449 arcane_shot Fluffy_Pillow 62.5/100: 62% focus thrill_of_the_hunt(3), megawatt_filament
1:33.452 arcane_shot Fluffy_Pillow 57.0/100: 57% focus thrill_of_the_hunt(2), megawatt_filament
1:34.457 arcane_shot Fluffy_Pillow 51.6/100: 52% focus thrill_of_the_hunt, megawatt_filament
1:35.461 explosive_shot Fluffy_Pillow 46.2/100: 46% focus lock_and_load(2), megawatt_filament
1:36.466 explosive_shot Fluffy_Pillow 50.8/100: 51% focus lock_and_load, megawatt_filament
1:37.470 explosive_shot Fluffy_Pillow 55.4/100: 55% focus megawatt_filament
1:38.474 black_arrow Fluffy_Pillow 44.9/100: 45% focus megawatt_filament
1:39.479 focusing_shot Fluffy_Pillow 14.5/100: 15% focus
1:41.676 barrage Fluffy_Pillow 74.5/100: 75% focus
1:44.433 explosive_shot Fluffy_Pillow 27.1/100: 27% focus
1:45.439 focusing_shot Fluffy_Pillow 16.7/100: 17% focus megawatt_filament
1:47.635 arcane_shot Fluffy_Pillow 76.7/100: 77% focus megawatt_filament
1:48.639 arcane_shot Fluffy_Pillow 51.3/100: 51% focus megawatt_filament
1:49.643 focusing_shot Fluffy_Pillow 25.9/100: 26% focus megawatt_filament
1:51.841 explosive_shot Fluffy_Pillow 85.9/100: 86% focus lock_and_load(2), megawatt_filament
1:52.844 explosive_shot Fluffy_Pillow 90.5/100: 90% focus lock_and_load, megawatt_filament
1:53.848 explosive_shot Fluffy_Pillow 95.0/100: 95% focus megawatt_filament
1:54.853 arcane_shot Fluffy_Pillow 84.6/100: 85% focus megawatt_filament
1:55.858 arcane_shot Fluffy_Pillow 59.2/100: 59% focus megawatt_filament
1:56.865 arcane_shot Fluffy_Pillow 33.8/100: 34% focus
1:57.869 focusing_shot Fluffy_Pillow 8.4/100: 8% focus
2:00.067 explosive_shot Fluffy_Pillow 68.4/100: 68% focus
2:01.072 arcane_shot Fluffy_Pillow 58.0/100: 58% focus
2:02.077 arcane_shot Fluffy_Pillow 32.6/100: 33% focus thrill_of_the_hunt(2)
2:03.081 arcane_shot Fluffy_Pillow 27.1/100: 27% focus thrill_of_the_hunt
2:04.085 potion Fluffy_Pillow 21.7/100: 22% focus spirit_of_the_warlords
2:04.085 focusing_shot Fluffy_Pillow 21.7/100: 22% focus spirit_of_the_warlords, draenic_agility_potion
2:06.282 black_arrow Fluffy_Pillow 81.7/100: 82% focus spirit_of_the_warlords, draenic_agility_potion
2:07.287 explosive_shot Fluffy_Pillow 51.3/100: 51% focus thrill_of_the_hunt(3), spirit_of_the_warlords, draenic_agility_potion
2:08.291 a_murder_of_crows Fluffy_Pillow 40.9/100: 41% focus thrill_of_the_hunt(3), spirit_of_the_warlords, draenic_agility_potion
2:09.296 arcane_shot Fluffy_Pillow 15.5/100: 15% focus thrill_of_the_hunt(3), spirit_of_the_warlords, draenic_agility_potion
2:10.301 arcane_shot Fluffy_Pillow 10.1/100: 10% focus thrill_of_the_hunt(2), spirit_of_the_warlords, draenic_agility_potion
2:11.305 focusing_shot Fluffy_Pillow 4.6/100: 5% focus thrill_of_the_hunt, spirit_of_the_warlords, draenic_agility_potion
2:13.502 explosive_shot Fluffy_Pillow 64.7/100: 65% focus thrill_of_the_hunt, spirit_of_the_warlords, draenic_agility_potion
2:14.507 arcane_shot Fluffy_Pillow 54.2/100: 54% focus thrill_of_the_hunt, spirit_of_the_warlords, draenic_agility_potion
2:15.512 explosive_shot Fluffy_Pillow 48.8/100: 49% focus lock_and_load(2), spirit_of_the_warlords, draenic_agility_potion
2:16.515 explosive_shot Fluffy_Pillow 53.4/100: 53% focus lock_and_load, spirit_of_the_warlords, draenic_agility_potion
2:17.520 explosive_shot Fluffy_Pillow 58.0/100: 58% focus lock_and_load(2), spirit_of_the_warlords, draenic_agility_potion
2:18.524 explosive_shot Fluffy_Pillow 62.6/100: 63% focus lock_and_load, spirit_of_the_warlords, draenic_agility_potion
2:19.527 explosive_shot Fluffy_Pillow 67.1/100: 67% focus spirit_of_the_warlords, draenic_agility_potion
2:20.529 arcane_shot Fluffy_Pillow 56.7/100: 57% focus spirit_of_the_warlords, draenic_agility_potion
2:21.533 arcane_shot Fluffy_Pillow 31.3/100: 31% focus spirit_of_the_warlords, draenic_agility_potion
2:22.537 focusing_shot Fluffy_Pillow 5.9/100: 6% focus spirit_of_the_warlords, draenic_agility_potion
2:24.735 barrage Fluffy_Pillow 65.9/100: 66% focus draenic_agility_potion
2:27.622 explosive_shot Fluffy_Pillow 19.0/100: 19% focus draenic_agility_potion
2:28.626 focusing_shot Fluffy_Pillow 8.6/100: 9% focus megawatt_filament, draenic_agility_potion
2:30.822 black_arrow Fluffy_Pillow 68.6/100: 69% focus megawatt_filament
2:31.826 arcane_shot Fluffy_Pillow 38.2/100: 38% focus thrill_of_the_hunt(3), megawatt_filament
2:32.830 arcane_shot Fluffy_Pillow 32.8/100: 33% focus thrill_of_the_hunt(2), megawatt_filament
2:33.835 explosive_shot Fluffy_Pillow 27.4/100: 27% focus thrill_of_the_hunt, megawatt_filament
2:34.839 arcane_shot Fluffy_Pillow 16.9/100: 17% focus thrill_of_the_hunt, megawatt_filament
2:35.843 focusing_shot Fluffy_Pillow 11.5/100: 12% focus megawatt_filament
2:38.041 arcane_shot Fluffy_Pillow 71.5/100: 72% focus megawatt_filament
2:39.046 arcane_shot Fluffy_Pillow 46.1/100: 46% focus megawatt_filament
2:40.051 explosive_shot Fluffy_Pillow 20.7/100: 21% focus
2:41.056 focusing_shot Fluffy_Pillow 10.3/100: 10% focus
2:43.253 explosive_shot Fluffy_Pillow 70.3/100: 70% focus lock_and_load(2)
2:44.256 explosive_shot Fluffy_Pillow 74.9/100: 75% focus lock_and_load
2:45.260 explosive_shot Fluffy_Pillow 79.5/100: 79% focus
2:46.263 barrage Fluffy_Pillow 69.0/100: 69% focus
2:49.151 focusing_shot Fluffy_Pillow 22.2/100: 22% focus
2:51.348 explosive_shot Fluffy_Pillow 82.2/100: 82% focus
2:52.353 arcane_shot Fluffy_Pillow 71.8/100: 72% focus
2:53.358 arcane_shot Fluffy_Pillow 46.4/100: 46% focus
2:54.361 focusing_shot Fluffy_Pillow 21.0/100: 21% focus
2:56.560 black_arrow Fluffy_Pillow 81.0/100: 81% focus
2:57.566 explosive_shot Fluffy_Pillow 50.6/100: 51% focus
2:58.570 arcane_shot Fluffy_Pillow 40.2/100: 40% focus
2:59.574 focusing_shot Fluffy_Pillow 14.7/100: 15% focus
3:01.771 arcane_shot Fluffy_Pillow 74.8/100: 75% focus
3:02.775 arcane_shot Fluffy_Pillow 49.3/100: 49% focus thrill_of_the_hunt(2)
3:03.780 explosive_shot Fluffy_Pillow 43.9/100: 44% focus thrill_of_the_hunt
3:04.784 arcane_shot Fluffy_Pillow 33.5/100: 33% focus thrill_of_the_hunt
3:05.788 explosive_shot Fluffy_Pillow 28.1/100: 28% focus lock_and_load(2)
3:06.792 explosive_shot Fluffy_Pillow 32.6/100: 33% focus lock_and_load
3:07.797 explosive_shot Fluffy_Pillow 37.2/100: 37% focus
3:08.802 focusing_shot Fluffy_Pillow 26.8/100: 27% focus
3:11.001 a_murder_of_crows Fluffy_Pillow 86.8/100: 87% focus
3:12.005 barrage Fluffy_Pillow 61.4/100: 61% focus
3:14.772 focusing_shot Fluffy_Pillow 14.0/100: 14% focus
3:16.970 explosive_shot Fluffy_Pillow 74.1/100: 74% focus
3:17.975 arcane_shot Fluffy_Pillow 63.6/100: 64% focus thrill_of_the_hunt(3)
3:18.979 arcane_shot Fluffy_Pillow 58.2/100: 58% focus thrill_of_the_hunt(2)
3:19.985 arcane_shot Fluffy_Pillow 52.8/100: 53% focus thrill_of_the_hunt
3:20.989 black_arrow Fluffy_Pillow 47.4/100: 47% focus
3:21.994 arcane_shot Fluffy_Pillow 17.0/100: 17% focus thrill_of_the_hunt(3)
3:22.997 arcane_shot Fluffy_Pillow 11.5/100: 12% focus thrill_of_the_hunt(2)
3:24.001 explosive_shot Fluffy_Pillow 6.1/100: 6% focus thrill_of_the_hunt, lock_and_load(2)
3:25.008 explosive_shot Fluffy_Pillow 10.7/100: 11% focus thrill_of_the_hunt, lock_and_load
3:26.013 explosive_shot Fluffy_Pillow 15.3/100: 15% focus thrill_of_the_hunt, lock_and_load(2)
3:27.018 explosive_shot Fluffy_Pillow 19.9/100: 20% focus thrill_of_the_hunt, lock_and_load
3:28.024 explosive_shot Fluffy_Pillow 24.5/100: 24% focus thrill_of_the_hunt
3:29.028 arcane_shot Fluffy_Pillow 14.0/100: 14% focus thrill_of_the_hunt
3:30.033 explosive_shot Fluffy_Pillow 8.6/100: 9% focus lock_and_load(2)
3:31.038 explosive_shot Fluffy_Pillow 13.2/100: 13% focus lock_and_load
3:32.044 explosive_shot Fluffy_Pillow 17.8/100: 18% focus
3:33.046 focusing_shot Fluffy_Pillow 7.4/100: 7% focus
3:35.243 barrage Fluffy_Pillow 67.4/100: 67% focus thrill_of_the_hunt(3)
3:38.176 explosive_shot Fluffy_Pillow 20.7/100: 21% focus thrill_of_the_hunt(3)
3:39.179 arcane_shot Fluffy_Pillow 10.3/100: 10% focus thrill_of_the_hunt(3)
3:40.184 focusing_shot Fluffy_Pillow 4.9/100: 5% focus thrill_of_the_hunt(2)
3:42.381 arcane_shot Fluffy_Pillow 64.9/100: 65% focus thrill_of_the_hunt(2)
3:43.385 arcane_shot Fluffy_Pillow 59.5/100: 59% focus thrill_of_the_hunt
3:44.388 explosive_shot Fluffy_Pillow 54.1/100: 54% focus
3:45.392 black_arrow Fluffy_Pillow 43.7/100: 44% focus thrill_of_the_hunt(3)
3:46.396 arcane_shot Fluffy_Pillow 13.2/100: 13% focus thrill_of_the_hunt(3)
3:47.401 focusing_shot Fluffy_Pillow 7.8/100: 8% focus thrill_of_the_hunt(2)
3:49.598 arcane_shot Fluffy_Pillow 67.8/100: 68% focus thrill_of_the_hunt(2)
3:50.603 explosive_shot Fluffy_Pillow 62.4/100: 62% focus thrill_of_the_hunt(2)
3:51.607 arcane_shot Fluffy_Pillow 52.0/100: 52% focus thrill_of_the_hunt(2)
3:52.610 explosive_shot Fluffy_Pillow 46.6/100: 47% focus thrill_of_the_hunt, lock_and_load(2)
3:53.617 explosive_shot Fluffy_Pillow 51.2/100: 51% focus thrill_of_the_hunt, lock_and_load
3:54.622 explosive_shot Fluffy_Pillow 55.7/100: 56% focus thrill_of_the_hunt
3:55.626 arcane_shot Fluffy_Pillow 45.3/100: 45% focus thrill_of_the_hunt
3:56.631 arcane_shot Fluffy_Pillow 39.9/100: 40% focus
3:57.636 arcane_shot Fluffy_Pillow 14.5/100: 14% focus thrill_of_the_hunt(2)
3:58.639 focusing_shot Fluffy_Pillow 9.1/100: 9% focus thrill_of_the_hunt
4:00.837 explosive_shot Fluffy_Pillow 69.1/100: 69% focus thrill_of_the_hunt, spirit_of_the_warlords
4:01.841 arcane_shot Fluffy_Pillow 58.7/100: 59% focus thrill_of_the_hunt, spirit_of_the_warlords
4:02.844 arcane_shot Fluffy_Pillow 53.2/100: 53% focus spirit_of_the_warlords
4:03.848 focusing_shot Fluffy_Pillow 27.8/100: 28% focus spirit_of_the_warlords
4:06.047 barrage Fluffy_Pillow 87.8/100: 88% focus spirit_of_the_warlords, megawatt_filament
4:08.907 explosive_shot Fluffy_Pillow 40.9/100: 41% focus spirit_of_the_warlords, megawatt_filament
4:09.911 arcane_shot Fluffy_Pillow 30.5/100: 30% focus spirit_of_the_warlords, megawatt_filament
4:10.914 focusing_shot Fluffy_Pillow 5.0/100: 5% focus thrill_of_the_hunt(2), spirit_of_the_warlords, megawatt_filament
4:13.112 black_arrow Fluffy_Pillow 65.0/100: 65% focus thrill_of_the_hunt(2), spirit_of_the_warlords, megawatt_filament
4:14.117 a_murder_of_crows Fluffy_Pillow 34.6/100: 35% focus thrill_of_the_hunt(2), spirit_of_the_warlords, megawatt_filament
4:15.121 focusing_shot Fluffy_Pillow 9.2/100: 9% focus thrill_of_the_hunt(2), spirit_of_the_warlords, megawatt_filament
4:17.320 explosive_shot Fluffy_Pillow 69.2/100: 69% focus thrill_of_the_hunt(2), spirit_of_the_warlords
4:18.326 arcane_shot Fluffy_Pillow 58.8/100: 59% focus thrill_of_the_hunt(2), spirit_of_the_warlords
4:19.329 arcane_shot Fluffy_Pillow 53.4/100: 53% focus thrill_of_the_hunt, spirit_of_the_warlords
4:20.334 explosive_shot Fluffy_Pillow 48.0/100: 48% focus lock_and_load(2), spirit_of_the_warlords
4:21.338 explosive_shot Fluffy_Pillow 52.6/100: 53% focus lock_and_load
4:22.343 explosive_shot Fluffy_Pillow 57.1/100: 57% focus
4:23.349 arcane_shot Fluffy_Pillow 46.7/100: 47% focus thrill_of_the_hunt(3)
4:24.354 arcane_shot Fluffy_Pillow 41.3/100: 41% focus thrill_of_the_hunt(2)
4:25.359 arcane_shot Fluffy_Pillow 35.9/100: 36% focus thrill_of_the_hunt
4:26.363 arcane_shot Fluffy_Pillow 30.5/100: 30% focus
4:27.368 focusing_shot Fluffy_Pillow 5.0/100: 5% focus
4:29.565 explosive_shot Fluffy_Pillow 65.1/100: 65% focus
4:30.570 arcane_shot Fluffy_Pillow 54.6/100: 55% focus
4:31.573 focusing_shot Fluffy_Pillow 29.2/100: 29% focus
4:33.769 barrage Fluffy_Pillow 89.2/100: 89% focus
4:36.704 explosive_shot Fluffy_Pillow 42.6/100: 43% focus
4:37.708 arcane_shot Fluffy_Pillow 32.2/100: 32% focus
4:38.714 focusing_shot Fluffy_Pillow 6.8/100: 7% focus
4:40.912 black_arrow Fluffy_Pillow 66.8/100: 67% focus
4:41.916 arcane_shot Fluffy_Pillow 36.4/100: 36% focus thrill_of_the_hunt(3)
4:42.919 explosive_shot Fluffy_Pillow 31.0/100: 31% focus thrill_of_the_hunt(2)
4:43.922 arcane_shot Fluffy_Pillow 20.5/100: 21% focus thrill_of_the_hunt(2)
4:44.925 arcane_shot Fluffy_Pillow 15.1/100: 15% focus thrill_of_the_hunt
4:45.930 focusing_shot Fluffy_Pillow 9.7/100: 10% focus
4:48.128 arcane_shot Fluffy_Pillow 69.7/100: 70% focus
4:49.131 explosive_shot Fluffy_Pillow 44.3/100: 44% focus thrill_of_the_hunt(2)
4:50.135 arcane_shot Fluffy_Pillow 33.9/100: 34% focus thrill_of_the_hunt(2)
4:51.138 arcane_shot Fluffy_Pillow 28.4/100: 28% focus thrill_of_the_hunt
4:52.142 focusing_shot Fluffy_Pillow 23.0/100: 23% focus
4:54.339 barrage Fluffy_Pillow 83.0/100: 83% focus
4:57.209 explosive_shot Fluffy_Pillow 36.1/100: 36% focus
4:58.214 explosive_shot Fluffy_Pillow 25.7/100: 26% focus lock_and_load(2), megawatt_filament
4:59.219 explosive_shot Fluffy_Pillow 30.3/100: 30% focus lock_and_load, megawatt_filament
5:00.223 explosive_shot Fluffy_Pillow 34.9/100: 35% focus megawatt_filament
5:01.229 focusing_shot Fluffy_Pillow 24.4/100: 24% focus megawatt_filament

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 926 882 882
Agility 4337 3868 3749 (1549)
Stamina 4361 3965 3965
Intellect 896 854 854
Spirit 711 711 711
Health 261660 237900 0
Focus 100 100 0
Crit 34.28% 28.37% 1471
Haste 13.99% 8.56% 749
Multistrike 11.06% 6.06% 400
Damage / Heal Versatility 4.39% 1.39% 181
Attack Power 4771 3868 0
Mastery 15.27% 10.27% 250
Armor 1224 1224 1224

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rapáx"
origin="http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/202/480970-avatar.jpg"
level=100
race=night_elf
role=attack
position=ranged_back
professions=skinning=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!2022021
glyphs=liberation/deterrence/animal_bond/aspect_of_the_pack/aspect_of_the_cheetah/tame_beast
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=hood_of_dispassionate_execution,id=113608,bonus_id=566
neck=stormshot_choker,id=109950,bonus_id=499/524,enchant=40crit
shoulders=gruntslayer_shoulderguards,id=115414
back=cloak_of_creeping_necrosis,id=113657,enchant=gift_of_critical_strike
chest=crackleproof_chestguard,id=116029
shirt=artisan_officers_shirt,id=89195
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=40
hands=grips_of_vicious_mauling,id=113593
waist=belt_of_imminent_lies,id=113827,bonus_id=566
legs=wayfaring_leggings,id=116189,bonus_id=83/526/536
feet=wayfaring_boots,id=116193,bonus_id=131/525/535
finger1=ceds_chiming_circle,id=109760,bonus_id=524,enchant=30crit
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
trinket1=bloodmaws_tooth,id=116289
trinket2=skull_of_war,id=112318,bonus_id=525/530
main_hand=crystalline_branch_of_the_brackenspore,id=113652,enchant=megawatt_filament

# Gear Summary
# gear_agility=2397
# gear_stamina=3075
# gear_crit_rating=1471
# gear_haste_rating=749
# gear_mastery_rating=250
# gear_armor=1224
# gear_multistrike_rating=381
# gear_versatility_rating=181
# gear_avoidance_rating=68
summon_pet=cat

Rosalîîe

Rosalîîe : 24890 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24890.1 24890.1 7.2 / 0.029% 2296.1 / 9.2% 2900.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.6 Focus 0.00% 45.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced
Talents
  • 15: Posthaste
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Thrill of the Hunt
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Deterrence
  • Glyph of Black Ice
  • Glyph of Liberation
  • Glyph of Aspect of the Cheetah
Professions
  • engineering: 668
  • enchanting: 700

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:94449|88431|27194|22557|15540|5459|2936&chds=0,188898&chco=C79C6E,9482C9,C41F3B,C79C6E,69CCF0,ABD473,C79C6E&chm=t++94449++a_murder_of_crows,C79C6E,0,0,15|t++88431++black_arrow,9482C9,1,0,15|t++27194++explosive_shot,C41F3B,2,0,15|t++22557++barrage,C79C6E,3,0,15|t++15540++arcane_shot,69CCF0,4,0,15|t++5459++cobra_shot,ABD473,5,0,15|t++2936++auto_shot,C79C6E,6,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:27,15,13,10,10,10,9,7&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,ABD473,C79C6E,ABD473,C79C6E,69CCF0,C79C6E&chl=explosive_shot|black_arrow|serpent_sting|auto_shot|cobra_shot|barrage|arcane_shot|crow_peck&
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:adgkmqtxz3478754200zxwvttrpoonnnnnnooonnmlmlkkkijiihihiiikkkmnnoooppppppppooonnnmmmmmmmmlkkkjjjiiihihhhhhhhiijjkkkjkjjjjkkkkkllmmmnnoopqqpqpooonnmlkkjjjiiihiiijjjkjkjjjjjiiiiiiiiiiijjkklmmnnooooooooonnnmmmllllllllkkkkjjjjjjiiiiiiiiijjjkkkkkkkklklllllmmmnnnoooppppppooonnmmllkkkjjjjjjjkkkkkkkkkkkkjkkjjjkkjkkllmnnoooppppppppppoooonnnmmmmmmmmmmmmmlmllllllllmlmmlmllljhfdcZYWTS&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.645803,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=24890|max=38541&chxp=1,1,65,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,3,4,3,15,30,58,97,126,239,316,441,609,774,967,1125,1371,1431,1570,1572,1677,1653,1570,1457,1319,1162,1023,909,741,619,500,399,301,239,182,143,116,67,48,34,27,24,13,6,5,4,5,1,2,1&chds=0,1677&chbh=5&chxt=x&chxl=0:|min=22855|avg=24890|max=27623&chxp=0,1,43,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:44.5,24.7,14.1,10.7,4.1,1.8&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,69CCF0,C79C6E,9482C9,C79C6E&chl=cobra_shot 134.1s|explosive_shot 74.3s|arcane_shot 42.5s|barrage 32.2s|black_arrow 12.5s|a_murder_of_crows 5.3s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rosalîîe 24890
a_murder_of_crows 0 (1667) 0.0% (6.7%) 5.3 62.17sec 94866 94449

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 5.28 77.45 77.45 1.0045 1.0000 0.00 0.00 0.00 6052.28 94448.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.5 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1667 6.7% 0.0 0.00sec 0 0 Direct 77.5 4432 8863 5669 27.9% 35.6 1356 2712 27.9%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 77.45 0.00 0.00 0.0000 0.0000 500862.81 769747.06 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.95 27.93% 2712.49 2456 3057 2712.70 0 3057 26997 41490 34.92
multistrike 25.68 72.07% 1356.32 1228 1528 1356.94 1228 1528 34825 53521 34.93
hit 55.84 72.09% 4431.91 4094 5095 4435.77 4178 4739 247471 380324 34.93
crit 21.61 27.91% 8863.02 8187 10189 8870.87 8187 10022 191570 294412 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 2200 8.8% 42.3 7.13sec 15609 15540 Direct 42.0 10570 21143 13525 28.0% 18.8 3834 7670 28.0%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.32 42.03 0.00 0.00 1.0045 0.0000 660571.35 660571.35 0.00 15539.56 15539.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.25 28.01% 7669.61 7380 8821 7609.38 0 8821 40298 40298 0.00
multistrike 13.50 71.99% 3833.51 3690 4411 3835.27 3690 4331 51758 51758 0.00
hit 30.29 72.05% 10569.84 10250 12252 10574.46 10250 11299 320112 320112 0.00
crit 11.75 27.95% 21142.60 20500 24504 21153.27 0 24504 248404 248404 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 2593 10.4% 108.6 2.79sec 7179 2936 Direct 108.6 4836 9672 6191 28.0% 47.7 1757 3513 28.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.56 108.56 0.00 0.00 2.4448 0.0000 779337.55 1197718.76 34.93 2936.50 2936.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.37 28.02% 3513.16 3373 4037 3515.01 3373 4037 46965 72178 34.93
multistrike 34.34 71.98% 1756.55 1687 2018 1757.59 1687 1908 60327 92713 34.93
hit 78.14 71.98% 4835.68 4685 5607 4838.04 4735 4953 377869 580725 34.93
crit 30.41 28.02% 9672.32 9370 11214 9677.01 9370 10292 294177 452103 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2414 9.7% 11.6 25.63sec 62846 22557 Periodic 184.5 2491 4982 3188 28.0% 77.9 1383 2766 28.0% 9.7%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.56 11.56 184.89 184.52 2.7861 0.1585 726248.68 1042053.35 30.31 22557.11 22557.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.8 27.99% 2766.39 2675 3198 2767.40 2675 3161 60360 60360 0.00
multistrike 56.1 72.01% 1383.15 1338 1599 1383.74 1338 1514 77625 77625 0.00
hit 132.9 72.03% 2491.25 2418 2890 2492.52 2418 2590 331102 508852 34.93
crit 51.6 27.97% 4982.14 4836 5780 4984.61 4836 5274 257161 395216 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 3670 14.7% 12.4 25.15sec 88823 88431 Periodic 120.1 6189 12379 7921 28.0% 52.8 2250 4501 28.0% 79.8%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.42 12.41 120.11 120.11 1.0045 2.0000 1103441.88 1103441.88 0.00 4366.59 88430.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.95 72.13% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.46 27.87% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.8 28.01% 4500.64 4292 5342 4503.87 4292 5342 66517 66517 0.00
multistrike 38.0 71.99% 2250.34 2146 2671 2252.10 2146 2465 85479 85479 0.00
hit 86.5 72.01% 6189.08 5962 7419 6192.99 6057 6368 535344 535344 0.00
crit 33.6 27.99% 12379.03 11923 14838 12386.55 11923 13458 416102 416102 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cobra_shot 2433 9.8% 78.4 3.76sec 9337 5459 Direct 78.2 6319 12638 8087 28.0% 33.9 2291 4583 27.9%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.39 78.20 0.00 0.00 1.7102 0.0000 731903.54 731903.54 0.00 5459.44 5459.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.48 27.93% 4582.74 4428 5293 4584.32 0 5293 43425 43425 0.00
multistrike 24.45 72.07% 2291.43 2214 2646 2292.67 2214 2502 56020 56020 0.00
hit 56.32 72.01% 6318.64 6150 7351 6321.48 6150 6560 355836 355836 0.00
crit 21.89 27.99% 12637.57 12300 14702 12643.08 12300 13594 276623 276623 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
explosive_shot 6719 27.0% 74.0 4.07sec 27316 27194 Direct 73.7 4645 9289 5944 28.0% 32.7 1689 3380 27.9%  
Periodic 166.7 6111 12217 7823 28.0% 73.3 2210 4417 28.0% 55.4%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.96 73.74 166.68 166.68 1.0045 1.0000 2020273.40 2020273.40 0.00 8383.71 27193.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.14 27.93% 3379.62 3219 4006 3381.49 0 4006 30894 30894 0.00
multistrike 23.59 72.07% 1689.39 1610 2003 1690.52 1610 1905 39854 39854 0.00
hit 53.10 72.01% 4644.76 4471 5564 4647.58 4490 4871 246648 246648 0.00
crit 20.64 27.99% 9288.50 8943 11129 9293.94 8943 10218 191697 191697 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 20.5 27.98% 4416.70 3220 11723 4414.62 3273 6389 90599 90599 0.00
multistrike 52.8 72.02% 2209.72 1610 5851 2208.70 1805 2927 116682 116682 0.00
hit 120.0 71.97% 6111.01 4472 16288 6111.44 5411 7114 733073 733073 0.00
crit 46.7 28.03% 12216.67 8943 32506 12216.73 10095 16103 570826 570826 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
serpent_sting 3194 12.8% 42.0 7.15sec 22847 0 Periodic 139.9 4626 9251 5921 28.0% 61.1 1692 3384 28.0% 97.5%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.03 42.03 139.87 139.87 0.0000 2.0984 960355.12 960355.12 0.00 3271.91 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.24 71.95% 0.00 0 0 0.00 0 0 0 0 0.00
crit 11.79 28.05% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.1 27.96% 3383.69 3250 4045 3386.01 3250 4045 57779 57779 0.00
multistrike 44.0 72.04% 1692.27 1625 2022 1693.38 1625 1866 74444 74444 0.00
hit 100.7 72.00% 4625.60 0 5618 4628.12 4433 4807 465835 465835 0.00
crit 39.2 28.00% 9250.59 3 11235 9255.41 8278 9911 362297 362297 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rosalîîe
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
balanced_fate 5.7 0.0 51.1sec 50.5sec 18.63% 18.65% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_balanced_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:2004.00

Stack Uptimes

  • balanced_fate_1:18.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177038
  • name:Balanced Fate
  • tooltip:Increases Multistrike by {$s1=1135}.
  • description:Increases Multistrike by {$s1=1135} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 190.4sec 0.0sec 15.11% 15.13% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.8 0.2 20.1sec 19.8sec 8.89% 39.99% 0.2(0.2)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:4.97%
  • lock_and_load_2:3.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
oglethorpes_missile_splitter 7.2 2.4 44.0sec 31.7sec 32.70% 32.71% 2.4(2.4)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_oglethorpes_missile_splitter
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:750.00

Stack Uptimes

  • oglethorpes_missile_splitter_1:32.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156055
  • name:Oglethorpe's Missile Splitter
  • tooltip:Multistrike increased by $w1.
  • description:Multistrike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
thrill_of_the_hunt 10.8 3.7 27.4sec 20.0sec 33.07% 79.29% 3.7(7.7)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • thrill_of_the_hunt_1:7.63%
  • thrill_of_the_hunt_2:10.60%
  • thrill_of_the_hunt_3:14.84%

Trigger Attempt Success

  • trigger_pct:13.05%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rosalîîe
a_murder_of_crows Focus 5.3 158.4 30.0 30.0 3162.2
arcane_shot Focus 42.3 629.0 14.9 14.9 1050.2
barrage Focus 11.6 693.4 60.0 60.0 1047.4
black_arrow Focus 12.4 434.8 35.0 35.0 2537.8
explosive_shot Focus 74.0 664.2 9.0 9.0 3041.5
Resource Gains Type Count Total Average Overflow
focus_regen Focus 223.36 1406.49 (44.28%) 6.30 8.27 0.58%
external_healing Health 8.84 0.00 (0.00%) 0.00 82237.45 100.00%
thrill_of_the_hunt_savings Focus 33.87 677.37 (21.33%) 20.00 0.00 0.00%
cobra_shot Focus 78.20 1092.47 (34.39%) 13.97 2.39 0.22%
Resource RPS-Gain RPS-Loss
Focus 8.30 8.57
Combat End Resource Mean Min Max
Focus 19.23 0.01 96.09
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.3%
cat-Focus Cap 0.3%
devilsaur-Focus Cap 0.3%
raptor-Focus Cap 0.3%
hyena-Focus Cap 0.3%
wolf-Focus Cap 0.3%
wasp-Focus Cap 0.3%
t17_pet_2-Focus Cap 0.3%
t17_pet_1-Focus Cap 0.3%
dire_beast_1-Focus Cap 0.3%
dire_beast_2-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%

Procs

Count Interval
starved: black_arrow 2.4 34.0sec
starved: explosive_shot 0.7 55.2sec
starved: a_murder_of_crows 1.3 41.6sec
starved: barrage 17.2 16.9sec
thrill_of_the_hunt 14.5 20.0sec
lock_and_load 15.0 19.8sec

Statistics & Data Analysis

Fight Length
Sample Data Rosalîîe Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Rosalîîe Damage Per Second
Count 25000
Mean 24890.10
Minimum 22855.43
Maximum 27623.05
Spread ( max - min ) 4767.62
Range [ ( max - min ) / 2 * 100% ] 9.58%
Standard Deviation 584.5617
5th Percentile 23985.45
95th Percentile 25899.24
( 95th Percentile - 5th Percentile ) 1913.79
Mean Distribution
Standard Deviation 3.6971
95.00% Confidence Intervall ( 24882.86 - 24897.35 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2118
0.1 Scale Factor Error with Delta=300 2917
0.05 Scale Factor Error with Delta=300 11668
0.01 Scale Factor Error with Delta=300 291705
Distribution Chart
DPS(e)
Sample Data Rosalîîe Damage Per Second (Effective)
Count 25000
Mean 24890.10
Minimum 22855.43
Maximum 27623.05
Spread ( max - min ) 4767.62
Range [ ( max - min ) / 2 * 100% ] 9.58%
Damage
Sample Data Rosalîîe Damage
Count 25000
Mean 7482994.33
Minimum 5460235.27
Maximum 9552311.11
Spread ( max - min ) 4092075.85
Range [ ( max - min ) / 2 * 100% ] 27.34%
DTPS
Sample Data Rosalîîe Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rosalîîe Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rosalîîe Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rosalîîe Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rosalîîe Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rosalîîe Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RosalîîeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rosalîîe Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 use_item,name=belt_of_imminent_lies
9 0.00 arcane_torrent,if=focus.deficit>=30
A 0.00 blood_fury
B 0.00 berserking
C 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
D 0.00 call_action_list,name=aoe,if=active_enemies>1
E 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
F 12.42 black_arrow,if=!ticking
G 73.96 explosive_shot
H 5.28 a_murder_of_crows
I 0.00 dire_beast
J 39.43 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
K 0.00 glaive_toss
L 0.00 powershot
M 11.56 barrage
N 0.00 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
O 2.89 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
P 0.00 focusing_shot
Q 78.83 cobra_shot

Sample Sequence

0167FGHJQJJGGGQQMJGGGGJQJQFGQQQOGMQQJGGGGJJQQGFQQMGQQQGHJQGGGQQFMGQQJQGJJQGGGGJQQFGQMQGGGQJQJGJQQQFGHGGGJJQJQGMQQGQQFQGJQQQGGGGMQJGQQFQGQQGGGJMQGQHQQGFJQQGQGGGMJQGJQJQGFQQGGGGGGGGMJQGQQQFGJJJCQHGQQQGGGGMQJGQQFQGQQGGGJJJQQGMQJGQQ

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.006 explosive_shot Fluffy_Pillow 70.9/100: 71% focus bloodlust, thrill_of_the_hunt(3), balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:02.009 a_murder_of_crows Fluffy_Pillow 61.8/100: 62% focus bloodlust, thrill_of_the_hunt(3), balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:03.012 arcane_shot Fluffy_Pillow 37.7/100: 38% focus bloodlust, thrill_of_the_hunt(3), balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:04.015 cobra_shot Fluffy_Pillow 33.6/100: 34% focus bloodlust, thrill_of_the_hunt(2), balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:05.377 arcane_shot Fluffy_Pillow 41.7/100: 42% focus bloodlust, thrill_of_the_hunt(2), balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:06.380 arcane_shot Fluffy_Pillow 51.6/100: 52% focus bloodlust, thrill_of_the_hunt, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:07.385 explosive_shot Fluffy_Pillow 47.5/100: 47% focus bloodlust, lock_and_load(2), balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:08.388 explosive_shot Fluffy_Pillow 53.4/100: 53% focus bloodlust, lock_and_load, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:09.391 explosive_shot Fluffy_Pillow 59.3/100: 59% focus bloodlust, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:10.394 cobra_shot Fluffy_Pillow 50.2/100: 50% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:11.758 cobra_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:13.120 barrage Fluffy_Pillow 80.2/100: 80% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion
0:15.387 arcane_shot Fluffy_Pillow 47.6/100: 48% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion
0:16.392 explosive_shot Fluffy_Pillow 43.5/100: 44% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:17.398 explosive_shot Fluffy_Pillow 34.4/100: 34% focus bloodlust, thrill_of_the_hunt(2), lock_and_load(2), draenic_agility_potion
0:18.402 explosive_shot Fluffy_Pillow 40.3/100: 40% focus bloodlust, thrill_of_the_hunt(2), lock_and_load, draenic_agility_potion
0:19.408 explosive_shot Fluffy_Pillow 46.3/100: 46% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:20.412 arcane_shot Fluffy_Pillow 37.2/100: 37% focus bloodlust, thrill_of_the_hunt(2)
0:21.416 cobra_shot Fluffy_Pillow 33.1/100: 33% focus bloodlust, thrill_of_the_hunt
0:22.777 arcane_shot Fluffy_Pillow 41.1/100: 41% focus bloodlust, thrill_of_the_hunt
0:23.780 cobra_shot Fluffy_Pillow 51.0/100: 51% focus bloodlust
0:25.142 black_arrow Fluffy_Pillow 59.0/100: 59% focus bloodlust
0:26.145 explosive_shot Fluffy_Pillow 43.9/100: 44% focus bloodlust
0:27.151 cobra_shot Fluffy_Pillow 34.9/100: 35% focus bloodlust
0:28.514 cobra_shot Fluffy_Pillow 42.9/100: 43% focus bloodlust
0:29.878 cobra_shot Fluffy_Pillow 64.9/100: 65% focus bloodlust
0:31.240 arcane_shot Fluffy_Pillow 86.9/100: 87% focus bloodlust, balanced_fate
0:32.245 explosive_shot Fluffy_Pillow 76.8/100: 77% focus bloodlust, balanced_fate
0:33.251 barrage Fluffy_Pillow 67.8/100: 68% focus bloodlust, thrill_of_the_hunt(3), balanced_fate
0:35.498 cobra_shot Fluffy_Pillow 21.0/100: 21% focus bloodlust, thrill_of_the_hunt(3), balanced_fate
0:36.861 cobra_shot Fluffy_Pillow 29.0/100: 29% focus bloodlust, thrill_of_the_hunt(3), balanced_fate, oglethorpes_missile_splitter
0:38.225 arcane_shot Fluffy_Pillow 51.1/100: 51% focus bloodlust, thrill_of_the_hunt(3), balanced_fate, oglethorpes_missile_splitter
0:39.229 explosive_shot Fluffy_Pillow 61.0/100: 61% focus bloodlust, thrill_of_the_hunt(2), balanced_fate, oglethorpes_missile_splitter
0:40.232 explosive_shot Fluffy_Pillow 51.9/100: 52% focus bloodlust, thrill_of_the_hunt(2), lock_and_load(2), balanced_fate, oglethorpes_missile_splitter
0:41.236 explosive_shot Fluffy_Pillow 56.4/100: 56% focus thrill_of_the_hunt(2), lock_and_load, oglethorpes_missile_splitter
0:42.241 explosive_shot Fluffy_Pillow 61.0/100: 61% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
0:43.244 arcane_shot Fluffy_Pillow 50.5/100: 51% focus thrill_of_the_hunt(2), oglethorpes_missile_splitter
0:44.249 arcane_shot Fluffy_Pillow 45.1/100: 45% focus thrill_of_the_hunt, oglethorpes_missile_splitter
0:45.254 cobra_shot Fluffy_Pillow 39.6/100: 40% focus oglethorpes_missile_splitter
0:47.024 cobra_shot Fluffy_Pillow 47.6/100: 48% focus oglethorpes_missile_splitter
0:48.794 explosive_shot Fluffy_Pillow 69.6/100: 70% focus oglethorpes_missile_splitter
0:49.799 black_arrow Fluffy_Pillow 73.2/100: 73% focus
0:50.803 cobra_shot Fluffy_Pillow 42.7/100: 43% focus
0:52.573 cobra_shot Fluffy_Pillow 50.8/100: 51% focus
0:54.343 barrage Fluffy_Pillow 72.8/100: 73% focus
0:57.169 explosive_shot Fluffy_Pillow 39.6/100: 40% focus
0:58.173 cobra_shot Fluffy_Pillow 29.1/100: 29% focus
0:59.944 cobra_shot Fluffy_Pillow 37.1/100: 37% focus
1:01.713 cobra_shot Fluffy_Pillow 59.2/100: 59% focus
1:03.483 explosive_shot Fluffy_Pillow 81.2/100: 81% focus
1:04.488 a_murder_of_crows Fluffy_Pillow 84.7/100: 85% focus
1:05.493 arcane_shot Fluffy_Pillow 59.3/100: 59% focus
1:06.498 cobra_shot Fluffy_Pillow 33.8/100: 34% focus
1:08.269 explosive_shot Fluffy_Pillow 41.8/100: 42% focus lock_and_load(2)
1:09.275 explosive_shot Fluffy_Pillow 60.4/100: 60% focus lock_and_load
1:10.278 explosive_shot Fluffy_Pillow 64.9/100: 65% focus
1:11.283 cobra_shot Fluffy_Pillow 54.5/100: 54% focus
1:13.053 cobra_shot Fluffy_Pillow 62.5/100: 63% focus
1:14.824 black_arrow Fluffy_Pillow 84.5/100: 85% focus
1:15.829 barrage Fluffy_Pillow 68.1/100: 68% focus
1:18.812 explosive_shot Fluffy_Pillow 21.6/100: 22% focus
1:19.816 cobra_shot Fluffy_Pillow 11.1/100: 11% focus
1:21.586 cobra_shot Fluffy_Pillow 19.2/100: 19% focus
1:23.357 arcane_shot Fluffy_Pillow 41.2/100: 41% focus
1:24.362 cobra_shot Fluffy_Pillow 29.7/100: 30% focus thrill_of_the_hunt(2)
1:26.131 explosive_shot Fluffy_Pillow 37.7/100: 38% focus thrill_of_the_hunt(2), balanced_fate, oglethorpes_missile_splitter
1:27.134 arcane_shot Fluffy_Pillow 41.3/100: 41% focus thrill_of_the_hunt(2), balanced_fate, oglethorpes_missile_splitter
1:28.138 arcane_shot Fluffy_Pillow 35.8/100: 36% focus thrill_of_the_hunt(2), balanced_fate, oglethorpes_missile_splitter
1:29.143 cobra_shot Fluffy_Pillow 30.4/100: 30% focus thrill_of_the_hunt, balanced_fate, oglethorpes_missile_splitter
1:30.914 explosive_shot Fluffy_Pillow 38.4/100: 38% focus thrill_of_the_hunt, lock_and_load(2), balanced_fate, oglethorpes_missile_splitter
1:31.918 explosive_shot Fluffy_Pillow 56.9/100: 57% focus thrill_of_the_hunt, lock_and_load(2), balanced_fate, oglethorpes_missile_splitter
1:32.923 explosive_shot Fluffy_Pillow 61.5/100: 61% focus thrill_of_the_hunt, lock_and_load, balanced_fate, oglethorpes_missile_splitter
1:33.927 explosive_shot Fluffy_Pillow 66.0/100: 66% focus thrill_of_the_hunt, balanced_fate, oglethorpes_missile_splitter
1:34.931 arcane_shot Fluffy_Pillow 55.6/100: 56% focus thrill_of_the_hunt, balanced_fate, oglethorpes_missile_splitter
1:35.935 cobra_shot Fluffy_Pillow 50.1/100: 50% focus balanced_fate, oglethorpes_missile_splitter
1:37.705 cobra_shot Fluffy_Pillow 58.2/100: 58% focus oglethorpes_missile_splitter
1:39.474 black_arrow Fluffy_Pillow 80.2/100: 80% focus
1:40.479 explosive_shot Fluffy_Pillow 63.7/100: 64% focus
1:41.485 cobra_shot Fluffy_Pillow 53.3/100: 53% focus
1:43.257 barrage Fluffy_Pillow 61.3/100: 61% focus
1:46.179 cobra_shot Fluffy_Pillow 28.5/100: 29% focus
1:47.951 explosive_shot Fluffy_Pillow 36.6/100: 37% focus lock_and_load(2)
1:48.954 explosive_shot Fluffy_Pillow 55.1/100: 55% focus lock_and_load
1:49.959 explosive_shot Fluffy_Pillow 59.7/100: 60% focus
1:50.963 cobra_shot Fluffy_Pillow 49.2/100: 49% focus
1:52.734 arcane_shot Fluffy_Pillow 57.2/100: 57% focus
1:53.738 cobra_shot Fluffy_Pillow 45.8/100: 46% focus thrill_of_the_hunt(2)
1:55.508 arcane_shot Fluffy_Pillow 53.8/100: 54% focus thrill_of_the_hunt(2)
1:56.512 explosive_shot Fluffy_Pillow 62.3/100: 62% focus thrill_of_the_hunt
1:57.516 arcane_shot Fluffy_Pillow 51.9/100: 52% focus thrill_of_the_hunt
1:58.520 cobra_shot Fluffy_Pillow 46.4/100: 46% focus
2:00.292 cobra_shot Fluffy_Pillow 54.4/100: 54% focus oglethorpes_missile_splitter
2:02.064 cobra_shot Fluffy_Pillow 76.5/100: 76% focus oglethorpes_missile_splitter
2:03.835 black_arrow Fluffy_Pillow 98.5/100: 98% focus oglethorpes_missile_splitter
2:04.838 explosive_shot Fluffy_Pillow 82.0/100: 82% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter
2:05.843 a_murder_of_crows Fluffy_Pillow 71.6/100: 72% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter
2:06.848 explosive_shot Fluffy_Pillow 46.1/100: 46% focus thrill_of_the_hunt(3), lock_and_load(2), oglethorpes_missile_splitter
2:07.853 explosive_shot Fluffy_Pillow 50.7/100: 51% focus thrill_of_the_hunt(3), lock_and_load, oglethorpes_missile_splitter
2:08.857 explosive_shot Fluffy_Pillow 55.2/100: 55% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter
2:09.861 arcane_shot Fluffy_Pillow 44.8/100: 45% focus thrill_of_the_hunt(3), oglethorpes_missile_splitter
2:10.865 arcane_shot Fluffy_Pillow 39.3/100: 39% focus thrill_of_the_hunt(2), balanced_fate, oglethorpes_missile_splitter
2:11.868 cobra_shot Fluffy_Pillow 33.9/100: 34% focus thrill_of_the_hunt, balanced_fate, oglethorpes_missile_splitter
2:13.640 arcane_shot Fluffy_Pillow 41.9/100: 42% focus thrill_of_the_hunt, balanced_fate
2:14.643 cobra_shot Fluffy_Pillow 50.4/100: 50% focus balanced_fate
2:16.414 explosive_shot Fluffy_Pillow 58.5/100: 58% focus balanced_fate
2:17.418 barrage Fluffy_Pillow 62.0/100: 62% focus balanced_fate
2:20.313 cobra_shot Fluffy_Pillow 15.1/100: 15% focus balanced_fate
2:22.084 cobra_shot Fluffy_Pillow 23.1/100: 23% focus
2:23.855 explosive_shot Fluffy_Pillow 45.2/100: 45% focus
2:24.859 cobra_shot Fluffy_Pillow 48.7/100: 49% focus
2:26.629 cobra_shot Fluffy_Pillow 56.7/100: 57% focus oglethorpes_missile_splitter
2:28.400 black_arrow Fluffy_Pillow 78.7/100: 79% focus oglethorpes_missile_splitter
2:29.404 cobra_shot Fluffy_Pillow 62.3/100: 62% focus oglethorpes_missile_splitter
2:31.174 explosive_shot Fluffy_Pillow 70.3/100: 70% focus oglethorpes_missile_splitter
2:32.179 arcane_shot Fluffy_Pillow 73.9/100: 74% focus oglethorpes_missile_splitter
2:33.184 cobra_shot Fluffy_Pillow 48.4/100: 48% focus oglethorpes_missile_splitter
2:34.956 cobra_shot Fluffy_Pillow 56.4/100: 56% focus oglethorpes_missile_splitter
2:36.727 cobra_shot Fluffy_Pillow 78.5/100: 78% focus oglethorpes_missile_splitter
2:38.496 explosive_shot Fluffy_Pillow 100.0/100: 100% focus
2:39.499 explosive_shot Fluffy_Pillow 100.0/100: 100% focus lock_and_load(2)
2:40.505 explosive_shot Fluffy_Pillow 100.0/100: 100% focus lock_and_load
2:41.510 explosive_shot Fluffy_Pillow 100.0/100: 100% focus balanced_fate
2:42.514 barrage Fluffy_Pillow 89.5/100: 90% focus balanced_fate
2:45.399 cobra_shot Fluffy_Pillow 42.6/100: 43% focus balanced_fate
2:47.169 arcane_shot Fluffy_Pillow 50.6/100: 51% focus balanced_fate
2:48.173 explosive_shot Fluffy_Pillow 39.2/100: 39% focus balanced_fate
2:49.179 cobra_shot Fluffy_Pillow 28.7/100: 29% focus balanced_fate
2:50.951 cobra_shot Fluffy_Pillow 36.8/100: 37% focus balanced_fate
2:52.720 black_arrow Fluffy_Pillow 58.8/100: 59% focus
2:53.724 cobra_shot Fluffy_Pillow 42.3/100: 42% focus
2:55.494 explosive_shot Fluffy_Pillow 50.3/100: 50% focus
2:56.498 cobra_shot Fluffy_Pillow 53.9/100: 54% focus
2:58.267 cobra_shot Fluffy_Pillow 61.9/100: 62% focus
3:00.036 explosive_shot Fluffy_Pillow 83.9/100: 84% focus lock_and_load(2)
3:01.041 explosive_shot Fluffy_Pillow 100.0/100: 100% focus lock_and_load
3:02.045 explosive_shot Fluffy_Pillow 100.0/100: 100% focus
3:03.048 arcane_shot Fluffy_Pillow 89.5/100: 90% focus
3:04.051 barrage Fluffy_Pillow 64.1/100: 64% focus thrill_of_the_hunt(3)
3:06.988 cobra_shot Fluffy_Pillow 17.4/100: 17% focus thrill_of_the_hunt(3)
3:08.759 explosive_shot Fluffy_Pillow 25.4/100: 25% focus thrill_of_the_hunt(3)
3:09.763 cobra_shot Fluffy_Pillow 29.0/100: 29% focus thrill_of_the_hunt(3)
3:11.534 a_murder_of_crows Fluffy_Pillow 37.0/100: 37% focus thrill_of_the_hunt(3)
3:12.538 cobra_shot Fluffy_Pillow 25.5/100: 26% focus thrill_of_the_hunt(3)
3:14.309 cobra_shot Fluffy_Pillow 33.5/100: 34% focus thrill_of_the_hunt(3)
3:16.079 explosive_shot Fluffy_Pillow 55.6/100: 56% focus thrill_of_the_hunt(3)
3:17.084 black_arrow Fluffy_Pillow 59.1/100: 59% focus thrill_of_the_hunt(3)
3:18.088 arcane_shot Fluffy_Pillow 28.7/100: 29% focus thrill_of_the_hunt(3)
3:19.094 cobra_shot Fluffy_Pillow 23.2/100: 23% focus
3:20.865 cobra_shot Fluffy_Pillow 31.2/100: 31% focus
3:22.636 explosive_shot Fluffy_Pillow 53.3/100: 53% focus
3:23.641 cobra_shot Fluffy_Pillow 56.8/100: 57% focus
3:25.413 explosive_shot Fluffy_Pillow 64.8/100: 65% focus lock_and_load(2)
3:26.417 explosive_shot Fluffy_Pillow 83.4/100: 83% focus lock_and_load
3:27.420 explosive_shot Fluffy_Pillow 87.9/100: 88% focus
3:28.424 barrage Fluffy_Pillow 77.5/100: 77% focus thrill_of_the_hunt(3)
3:31.268 arcane_shot Fluffy_Pillow 30.3/100: 30% focus thrill_of_the_hunt(3)
3:32.274 cobra_shot Fluffy_Pillow 24.9/100: 25% focus thrill_of_the_hunt(2)
3:34.044 explosive_shot Fluffy_Pillow 32.9/100: 33% focus thrill_of_the_hunt(2)
3:35.049 arcane_shot Fluffy_Pillow 36.5/100: 36% focus thrill_of_the_hunt(2)
3:36.053 cobra_shot Fluffy_Pillow 31.0/100: 31% focus thrill_of_the_hunt
3:37.824 arcane_shot Fluffy_Pillow 39.0/100: 39% focus thrill_of_the_hunt
3:38.831 cobra_shot Fluffy_Pillow 47.6/100: 48% focus
3:40.601 explosive_shot Fluffy_Pillow 55.6/100: 56% focus
3:41.603 black_arrow Fluffy_Pillow 59.2/100: 59% focus
3:42.607 cobra_shot Fluffy_Pillow 28.7/100: 29% focus
3:44.377 cobra_shot Fluffy_Pillow 36.7/100: 37% focus oglethorpes_missile_splitter
3:46.148 explosive_shot Fluffy_Pillow 58.7/100: 59% focus lock_and_load(2), oglethorpes_missile_splitter
3:47.152 explosive_shot Fluffy_Pillow 77.3/100: 77% focus lock_and_load(2), oglethorpes_missile_splitter
3:48.157 explosive_shot Fluffy_Pillow 81.8/100: 82% focus lock_and_load, oglethorpes_missile_splitter
3:49.162 explosive_shot Fluffy_Pillow 86.4/100: 86% focus lock_and_load(2), oglethorpes_missile_splitter
3:50.168 explosive_shot Fluffy_Pillow 90.9/100: 91% focus lock_and_load, oglethorpes_missile_splitter
3:51.173 explosive_shot Fluffy_Pillow 95.5/100: 95% focus lock_and_load(2), oglethorpes_missile_splitter
3:52.177 explosive_shot Fluffy_Pillow 100.0/100: 100% focus lock_and_load, oglethorpes_missile_splitter
3:53.182 explosive_shot Fluffy_Pillow 100.0/100: 100% focus oglethorpes_missile_splitter
3:54.186 barrage Fluffy_Pillow 89.5/100: 90% focus oglethorpes_missile_splitter
3:57.053 arcane_shot Fluffy_Pillow 42.5/100: 43% focus
3:58.058 cobra_shot Fluffy_Pillow 17.1/100: 17% focus
3:59.828 explosive_shot Fluffy_Pillow 25.1/100: 25% focus
4:00.832 cobra_shot Fluffy_Pillow 28.6/100: 29% focus
4:02.603 cobra_shot Fluffy_Pillow 36.7/100: 37% focus
4:04.374 cobra_shot Fluffy_Pillow 58.7/100: 59% focus
4:06.144 black_arrow Fluffy_Pillow 80.7/100: 81% focus
4:07.149 explosive_shot Fluffy_Pillow 64.3/100: 64% focus thrill_of_the_hunt(3)
4:08.153 arcane_shot Fluffy_Pillow 53.8/100: 54% focus thrill_of_the_hunt(3)
4:09.159 arcane_shot Fluffy_Pillow 48.4/100: 48% focus thrill_of_the_hunt(2)
4:10.164 arcane_shot Fluffy_Pillow 42.9/100: 43% focus thrill_of_the_hunt, balanced_fate
4:11.170 potion Fluffy_Pillow 37.5/100: 37% focus balanced_fate
4:11.170 cobra_shot Fluffy_Pillow 37.5/100: 37% focus balanced_fate, draenic_agility_potion
4:12.940 a_murder_of_crows Fluffy_Pillow 45.5/100: 45% focus balanced_fate, draenic_agility_potion
4:13.944 explosive_shot Fluffy_Pillow 34.0/100: 34% focus balanced_fate, draenic_agility_potion
4:14.948 cobra_shot Fluffy_Pillow 23.6/100: 24% focus balanced_fate, draenic_agility_potion
4:16.719 cobra_shot Fluffy_Pillow 31.6/100: 32% focus balanced_fate, draenic_agility_potion
4:18.489 cobra_shot Fluffy_Pillow 53.6/100: 54% focus balanced_fate, draenic_agility_potion
4:20.261 explosive_shot Fluffy_Pillow 75.6/100: 76% focus draenic_agility_potion
4:21.267 explosive_shot Fluffy_Pillow 79.2/100: 79% focus lock_and_load(2), draenic_agility_potion
4:22.271 explosive_shot Fluffy_Pillow 83.7/100: 84% focus lock_and_load, draenic_agility_potion
4:23.275 explosive_shot Fluffy_Pillow 88.3/100: 88% focus draenic_agility_potion
4:24.280 barrage Fluffy_Pillow 77.8/100: 78% focus draenic_agility_potion
4:27.129 cobra_shot Fluffy_Pillow 30.7/100: 31% focus draenic_agility_potion
4:28.898 arcane_shot Fluffy_Pillow 38.8/100: 39% focus draenic_agility_potion
4:29.902 explosive_shot Fluffy_Pillow 27.3/100: 27% focus draenic_agility_potion
4:30.908 cobra_shot Fluffy_Pillow 16.9/100: 17% focus draenic_agility_potion
4:32.679 cobra_shot Fluffy_Pillow 24.9/100: 25% focus draenic_agility_potion
4:34.449 black_arrow Fluffy_Pillow 46.9/100: 47% focus draenic_agility_potion
4:35.455 cobra_shot Fluffy_Pillow 30.4/100: 30% focus draenic_agility_potion
4:37.224 explosive_shot Fluffy_Pillow 38.5/100: 38% focus
4:38.230 cobra_shot Fluffy_Pillow 42.0/100: 42% focus
4:40.003 cobra_shot Fluffy_Pillow 50.0/100: 50% focus
4:41.772 explosive_shot Fluffy_Pillow 72.1/100: 72% focus lock_and_load(2)
4:42.777 explosive_shot Fluffy_Pillow 90.6/100: 91% focus lock_and_load
4:43.782 explosive_shot Fluffy_Pillow 95.2/100: 95% focus
4:44.786 arcane_shot Fluffy_Pillow 84.7/100: 85% focus
4:45.791 arcane_shot Fluffy_Pillow 59.3/100: 59% focus thrill_of_the_hunt(2), balanced_fate
4:46.794 arcane_shot Fluffy_Pillow 53.8/100: 54% focus thrill_of_the_hunt, balanced_fate
4:47.799 cobra_shot Fluffy_Pillow 48.4/100: 48% focus balanced_fate
4:49.570 cobra_shot Fluffy_Pillow 56.4/100: 56% focus balanced_fate
4:51.342 explosive_shot Fluffy_Pillow 78.4/100: 78% focus balanced_fate
4:52.345 barrage Fluffy_Pillow 81.9/100: 82% focus balanced_fate, oglethorpes_missile_splitter
4:55.181 cobra_shot Fluffy_Pillow 34.8/100: 35% focus oglethorpes_missile_splitter
4:56.951 arcane_shot Fluffy_Pillow 42.8/100: 43% focus oglethorpes_missile_splitter
4:57.956 explosive_shot Fluffy_Pillow 31.4/100: 31% focus oglethorpes_missile_splitter
4:58.959 cobra_shot Fluffy_Pillow 20.9/100: 21% focus oglethorpes_missile_splitter
5:00.730 cobra_shot Fluffy_Pillow 28.9/100: 29% focus oglethorpes_missile_splitter

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 930 886 886
Agility 4510 4034 3906 (1460)
Stamina 4504 4095 4095
Intellect 895 853 853
Spirit 713 713 713
Health 270240 245700 0
Focus 100 100 0
Crit 30.98% 24.16% 1008
Haste 13.22% 7.83% 783
Multistrike 12.17% 7.17% 473
Damage / Heal Versatility 8.37% 5.37% 698
Attack Power 4961 4034 0
Mastery 15.74% 10.74% 301
Armor 1260 1260 1260
Run Speed 0 0 90

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rosalîîe"
origin="http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/37/85695781-avatar.jpg"
level=100
race=pandaren_alliance
role=attack
position=ranged_back
professions=engineering=668/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!0012022
glyphs=deterrence/black_ice/liberation/aspect_of_the_cheetah
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/use_item,name=belt_of_imminent_lies
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=hood_of_dispassionate_execution,id=113608
neck=earthcallers_charm,id=120083,enchant=75mult
shoulders=living_mountain_shoulderguards,id=113641,bonus_id=42
back=cloak_of_creeping_necrosis,id=113657,bonus_id=563,gems=35mult,enchant=gift_of_multistrike
chest=mosswoven_mailshirt,id=113654,bonus_id=561/566
wrists=bracers_of_the_crying_chorus,id=113826
hands=grips_of_vicious_mauling,id=113593,bonus_id=566
waist=belt_of_imminent_lies,id=113827,bonus_id=560,addon=nitro_boosts
legs=legguards_of_ravenous_assault,id=116032
feet=treads_of_sand_and_blood,id=113595,bonus_id=566
finger1=shifting_taladite_ring,id=115796,bonus_id=234/525/540,enchant=50mult
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50mult
trinket1=bloodmaws_tooth,id=116289
trinket2=scales_of_doom,id=113612,bonus_id=566
main_hand=grandiose_longbow,id=115329,bonus_id=490,enchant=oglethorpes_missile_splitter

# Gear Summary
# gear_agility=2560
# gear_stamina=3204
# gear_crit_rating=1008
# gear_haste_rating=783
# gear_mastery_rating=301
# gear_armor=1260
# gear_multistrike_rating=450
# gear_versatility_rating=698
# gear_speed_rating=90
summon_pet=cat

Procrank

Procrank : 25194 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
25193.7 25193.7 11.4 / 0.045% 3497.5 / 13.9% 7.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
2720.8 2720.8 Mana 0.00% 42.9 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Water Elemental
  • Glyph of Splitting Ice
  • Glyph of the Unbound Elemental
  • Glyph of Illusion
  • Glyph of Rapid Teleportation
Professions
  • inscription: 691
  • tailoring: 640

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Procrank+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:389010|36960|36324|34213|21123|11085&chds=0,778020&chco=69CCF0,0070DE,9900CC,0070DE,0070DE,0070DE&chm=t++389010++mirror_image,69CCF0,0,0,15|t++36960++ice_nova,0070DE,1,0,15|t++36324++frostfire_bolt,9900CC,2,0,15|t++34213++frozen_orb,0070DE,3,0,15|t++21123++ice_lance,0070DE,4,0,15|t++11085++frostbolt,0070DE,5,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,23,19,19,11,11,9,7,4,2,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,0070DE,9900CC,0070DE,C79C6E,0070DE&chl=ice_lance|frostbolt|frostfire_bolt|mirror_image: frostbolt|ice_nova|water_elemental: waterbolt|icicle_fb|icicle_ffb|frozen_orb_bolt|shattered_bleed|water_elemental: water_jet&
http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Procrank+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fjlorux0357685345553100ywwvtssrqqomkigeeccbbZYXWVUTSSSSTTTTUUTTSTTUVVVVVVUUTTTTSSSSSSSRQQQQRSSTTTTTTTTTTTTSTSSSRQQQRTUVWXXYZZabbcddefffedcbbbbcccbbbaaaaaaaZZZZZYXVVUUUTTSUUUTUVWWXXYZabcdeefgfghiihgfffeedccbbaaZYXVUUUVWWVVVUUUTTTTTTSSSSSSSSTUVXYZZaabcddefffeedddcaaaabbbbaaZZZZZZZYYYXXWWVTTSSTTTSSSSTTTTTUUUUUUVVUTTUTUUUUTTSSSSSSSRRRRRRRRQRRRSSSSSSSSSSSSSSSSTUUUUUVVUTSSRQPOO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.449047,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=25194|max=56105&chxp=1,1,45,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Procrank+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,9,25,32,46,78,119,152,237,296,441,525,633,777,833,967,1036,1109,1184,1220,1256,1262,1311,1348,1305,1223,1207,1109,978,910,738,649,523,396,301,260,148,111,82,53,28,30,20,12,7,1,4,1,1,3&chds=0,1348&chbh=5&chxt=x&chxl=0:|min=22311|avg=25194|max=28833&chxp=0,1,44,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:55.8,21.5,13.5,5.8,2.5,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 167.9s|ice_lance 64.7s|frostfire_bolt 40.6s|ice_nova 17.4s|frozen_orb 7.4s|mirror_image 2.7s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Procrank 25194
frostbolt 4411 (6195) 17.5% (24.6%) 101.0 2.95sec 18426 11085 Direct 100.8 9163 18477 10437 13.7% 85.4 2799 5670 14.2%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.02 100.79 0.00 0.00 1.6623 0.0000 1325632.19 1325632.19 0.00 11084.85 11084.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.09 14.15% 5670.28 5368 6512 5673.94 5368 6512 68545 68545 0.00
multistrike 73.32 85.85% 2798.80 2684 3256 2800.35 2724 2925 205203 205203 0.00
hit 87.00 86.32% 9162.50 8946 10853 9166.22 9019 9400 797116 797116 0.00
crit 13.79 13.68% 18476.93 17893 21705 18489.96 17893 21705 254768 254768 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1256} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 1784 7.1% 184.1 1.97sec 2911 0 Direct 183.0 2929 0 2929 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 184.08 182.97 0.00 0.00 0.0000 0.0000 535835.78 535835.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.97 100.00% 2928.63 1040 14094 2930.76 2307 3831 535836 535836 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3283.29
  • base_dd_max:3283.29
 
frostfire_bolt 3593 (4916) 14.2% (19.5%) 31.3 9.34sec 47100 36324 Direct 31.2 15452 31215 26655 71.1% 29.7 4734 9599 72.0%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.27 31.21 0.00 0.00 1.2967 0.0000 1076694.85 1076694.85 0.00 36324.21 36324.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.39 71.96% 9598.72 8991 10907 9605.27 8991 10667 205297 205297 0.00
multistrike 8.34 28.04% 4733.60 4495 5453 4735.68 0 5453 39458 39458 0.00
hit 9.03 28.92% 15452.24 14985 18178 15456.24 0 18178 139497 139497 0.00
crit 22.18 71.08% 31214.63 29970 36357 31237.92 29970 33619 692443 692443 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=1672}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1323 5.2% 60.3 5.10sec 6574 0 Direct 60.0 6607 0 6607 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.29 59.99 0.00 0.00 0.0000 0.0000 396360.95 396360.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.99 100.00% 6607.30 1040 14094 6617.01 5005 8504 396361 396361 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3283.29
  • base_dd_max:3283.29
 
frozen_orb 0 (849) 0.0% (3.4%) 5.4 60.85sec 46716 34213

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.44 5.44 53.35 53.35 1.3655 1.0000 0.00 0.00 0.00 4184.36 34213.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.5 83.46% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.8 16.54% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=405} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 849 3.4% 0.0 0.00sec 0 0 Direct 53.4 3111 6210 3625 16.6% 53.9 972 1940 16.5%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.35 0.00 0.00 0.0000 0.0000 254342.08 254342.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.88 16.49% 1939.69 1728 2096 1941.80 0 2096 17232 17232 0.00
multistrike 44.99 83.51% 971.52 864 1048 972.70 927 1034 43705 43705 0.00
hit 44.49 83.40% 3110.58 2880 3493 3114.51 3002 3282 138397 138397 0.00
crit 8.86 16.60% 6210.20 5759 6986 6217.15 0 6986 55008 55008 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=405} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 4553 18.1% 49.2 6.08sec 27766 21123 Direct 49.1 12534 25223 21682 72.1% 45.0 3877 7817 72.5%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.23 49.07 0.00 0.00 1.3145 0.0000 1366931.08 1366931.08 0.00 21123.30 21123.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 32.64 72.54% 7817.11 7210 8747 7824.58 7369 8405 255158 255158 0.00
multistrike 12.36 27.46% 3876.77 3605 4373 3880.83 3605 4373 47912 47912 0.00
hit 13.70 27.91% 12534.25 12017 14578 12543.32 12017 14578 171664 171664 0.00
crit 35.37 72.09% 25223.28 24034 29155 25243.83 24216 26960 892197 892197 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=422}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 2148 8.5% 13.4 23.09sec 47879 36960 Direct 13.4 31931 64112 36501 14.2% 13.5 9902 19902 14.5%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.45 13.45 0.00 0.00 1.2954 0.0000 643774.80 643774.80 0.00 36960.32 36960.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.95 14.47% 19902.43 18027 21868 17310.18 0 21868 38811 38811 0.00
multistrike 11.53 85.53% 9901.56 9013 10934 9920.15 9013 10934 114176 114176 0.00
hit 11.54 85.80% 31931.09 30045 36447 31957.55 30045 34313 368373 368373 0.00
crit 1.91 14.20% 64112.35 60089 72894 55823.31 0 72894 122414 122414 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=2109} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (3561) 0.0% (14.1%) 3.0 120.68sec 354506 389010

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.9113 0.0000 0.00 0.00 0.00 389010.04 389010.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.59 86.05% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.42 13.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 9566 14.1% 201.9 4.07sec 5280 3207 Direct 200.9 3443 6988 4074 17.8% 196.5 1058 2160 18.3%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.86 200.88 0.00 0.00 1.6463 0.0000 1065887.51 1065887.51 0.00 3207.46 3207.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 35.92 18.28% 2160.32 1983 2405 2161.76 2003 2324 77588 77588 0.00
multistrike 160.54 81.72% 1058.36 991 1203 1059.03 1034 1101 169909 169909 0.00
hit 165.11 82.19% 3442.72 3305 4009 3444.93 3387 3539 568437 568437 0.00
crit 35.77 17.81% 6988.02 6609 8018 6994.28 6609 7548 249953 249953 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 446 1.8% 16.9 18.20sec 7932 0 Direct 16.9 1584 3169 1805 13.9% 14.6 475 951 14.3%  
Periodic 95.5 785 0 785 0.0% 86.7 238 0 0.0% 31.7%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.90 16.90 95.50 95.50 0.0000 1.0000 134038.23 134038.23 0.00 1403.59 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.09 14.29% 950.68 951 951 826.18 0 951 1984 1984 0.00
multistrike 12.52 85.71% 475.34 475 475 475.34 475 475 5953 5953 0.00
hit 14.54 86.07% 1584.46 1584 1584 1584.46 1584 1584 23044 23044 0.00
crit 2.35 13.93% 3168.92 3169 3169 2879.92 0 3169 7460 7460 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 86.7 100.00% 237.67 238 238 237.67 238 238 20611 20611 0.00
hit 95.5 100.00% 785.22 1 792 785.44 758 792 74986 74986 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - water_elemental 2525 / 2525
water_jet 437 1.7% 10.0 30.28sec 13099 3038 Periodic 39.8 2261 4567 2601 14.7% 34.1 701 1421 15.3% 11.5%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.02 10.02 39.79 39.79 4.3119 0.8673 131210.49 131210.49 0.00 3037.98 3037.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.2 15.34% 1420.76 1303 1581 1418.09 0 1581 7440 7440 0.00
multistrike 28.9 84.66% 701.14 651 790 702.17 664 754 20263 20263 0.00
hit 33.9 85.26% 2261.11 2171 2634 2262.79 2185 2357 76709 76709 0.00
crit 5.9 14.74% 4567.50 4343 5268 4560.67 0 5268 26798 26798 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 2089 8.3% 112.8 2.65sec 5559 2540 Direct 111.9 3849 7759 4393 13.9% 100.1 1181 2389 14.3%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.83 111.92 0.00 0.00 2.1889 0.0000 627252.20 627252.20 0.00 2539.77 2539.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.36 14.35% 2389.05 2241 2718 2391.11 2241 2718 34311 34311 0.00
multistrike 85.74 85.65% 1180.76 1120 1359 1181.51 1150 1228 101239 101239 0.00
hit 96.32 86.07% 3848.56 3735 4530 3850.42 3768 3923 370701 370701 0.00
crit 15.60 13.93% 7758.69 7469 9061 7763.74 7469 8796 121001 121001 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=511} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 9566 / 3561
frostbolt 9566 14.1% 201.9 4.07sec 5280 3207 Direct 200.9 3443 6988 4074 17.8% 196.5 1058 2160 18.3%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.86 200.88 0.00 0.00 1.6463 0.0000 1065887.51 1065887.51 0.00 3207.46 3207.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 35.92 18.28% 2160.32 1983 2405 2161.76 2003 2324 77588 77588 0.00
multistrike 160.54 81.72% 1058.36 991 1203 1059.03 1034 1101 169909 169909 0.00
hit 165.11 82.19% 3442.72 3305 4009 3444.93 3387 3539 568437 568437 0.00
crit 35.77 17.81% 6988.02 6609 8018 6994.28 6609 7548 249953 249953 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Procrank
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 181.36sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 2.05 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.79 87.13% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.26 12.87% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.88 88.36% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.12 11.64% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 25.3 6.2 11.8sec 9.4sec 20.87% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:20.16%
  • brain_freeze_2:0.71%

Trigger Attempt Success

  • trigger_pct:31.38%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.9sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.7 0.0 17.5sec 18.2sec 7.25% 17.47% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 35.0 16.5 8.7sec 5.9sec 30.81% 100.00% 1.9(1.9)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:26.32%
  • fingers_of_frost_2:4.49%

Trigger Attempt Success

  • trigger_pct:24.74%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.9sec 181.3sec 22.57% 24.61% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
nightmare_fire 2.9 0.0 121.5sec 121.4sec 18.96% 18.97% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Procrank
frostbolt Mana 101.0 646539.8 6400.0 6400.0 2.9
frozen_orb Mana 5.4 87109.9 16000.0 15999.8 2.9
ice_lance Mana 49.2 78768.5 1600.0 1600.0 17.4
mirror_image Mana 3.0 6421.4 2135.7 2135.7 166.0
Resource Gains Type Count Total Average Overflow
external_healing Health 8.79 0.00 (0.00%) 0.00 81639.45 100.00%
mp5_regen Mana 200.97 815326.15 (100.00%) 4057.00 175916.20 17.75%
Resource RPS-Gain RPS-Loss
Mana 2709.14 2720.81
Combat End Resource Mean Min Max
Mana 156494.59 139935.21 160000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 22.1%
water_elemental-Mana Cap 22.1%
prismatic_crystal-Mana Cap 22.1%
mirror_image-Mana Cap 22.1%
mirror_image-Mana Cap 22.1%
mirror_image-Mana Cap 22.1%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Procrank Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Procrank Damage Per Second
Count 25000
Mean 25193.74
Minimum 22311.11
Maximum 28832.95
Spread ( max - min ) 6521.84
Range [ ( max - min ) / 2 * 100% ] 12.94%
Standard Deviation 919.0641
5th Percentile 23696.70
95th Percentile 26680.24
( 95th Percentile - 5th Percentile ) 2983.55
Mean Distribution
Standard Deviation 5.8127
95.00% Confidence Intervall ( 25182.34 - 25205.13 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5112
0.1 Scale Factor Error with Delta=300 7210
0.05 Scale Factor Error with Delta=300 28842
0.01 Scale Factor Error with Delta=300 721066
Distribution Chart
DPS(e)
Sample Data Procrank Damage Per Second (Effective)
Count 25000
Mean 25193.74
Minimum 22311.11
Maximum 28832.95
Spread ( max - min ) 6521.84
Range [ ( max - min ) / 2 * 100% ] 12.94%
Damage
Sample Data Procrank Damage
Count 25000
Mean 5733609.95
Minimum 4218885.72
Maximum 7467324.53
Spread ( max - min ) 3248438.82
Range [ ( max - min ) / 2 * 100% ] 28.33%
DTPS
Sample Data Procrank Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Procrank Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Procrank Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Procrank Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Procrank Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Procrank Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ProcrankTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Procrank Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.01 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.05 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.01 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.44 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.18 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 21.96 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 31.27 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 27.26 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.04 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 100.57 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678XnpqqszqqzxyzzxzzzzttxzztstxzztzztyzzxzzzzzzszzzznqzqtzztxyzzsqtxzzzzzztzzztsyzzxtxzzzztzDnqzszqqyzzzqtxzzxzzzszzztqtxyzzxzxzzttzzXbsnqttzztyzxxzzzstzzzzztzztxyzzxsxzzzxzztDznqzzqqsttqxyzztxxzzzztzsxzzzzttyzzxtxzzz

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana
Pre food Fluffy_Pillow 160000.0/160000: 100% mana
Pre water_elemental Fluffy_Pillow 160000.0/160000: 100% mana
Pre mirror_image Fluffy_Pillow 160000.0/160000: 100% mana
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 153600.0/160000: 96% mana fingers_of_frost, draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 153600.0/160000: 96% mana fingers_of_frost, draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 153600.0/160000: 96% mana fingers_of_frost, icy_veins, draenic_intellect_potion
0:01.365 ice_nova Fluffy_Pillow 143231.7/160000: 90% mana bloodlust, fingers_of_frost(2), icy_veins, draenic_intellect_potion
0:02.416 ice_lance Fluffy_Pillow 147567.9/160000: 92% mana bloodlust, fingers_of_frost(2), icy_veins, draenic_intellect_potion
0:03.467 ice_lance Fluffy_Pillow 150304.1/160000: 94% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:04.519 ice_nova Fluffy_Pillow 153044.5/160000: 96% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:05.571 frostbolt Fluffy_Pillow 157384.8/160000: 98% mana bloodlust, fingers_of_frost, icy_veins, enhanced_frostbolt, nightmare_fire, draenic_intellect_potion
0:06.623 ice_lance Fluffy_Pillow 155325.1/160000: 97% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:07.674 ice_lance Fluffy_Pillow 158061.3/160000: 99% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:08.723 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.122 ice_lance Fluffy_Pillow 159372.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.173 water_jet Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.173 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.576 frostbolt Fluffy_Pillow 159388.5/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:13.975 ice_lance Fluffy_Pillow 158760.5/160000: 99% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:15.027 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:16.428 frostbolt Fluffy_Pillow 159380.2/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:17.829 frostbolt Fluffy_Pillow 158760.5/160000: 99% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:19.229 frostbolt Fluffy_Pillow 158136.6/160000: 99% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:20.630 frostfire_bolt Fluffy_Pillow 157516.8/160000: 98% mana bloodlust, brain_freeze(2), fingers_of_frost, icy_veins, nightmare_fire
0:21.682 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire
0:22.736 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire
0:23.787 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, enhanced_frostbolt
0:24.839 frostbolt Fluffy_Pillow 157940.3/160000: 99% mana bloodlust, brain_freeze, icy_veins
0:26.239 frostfire_bolt Fluffy_Pillow 157316.4/160000: 98% mana bloodlust, brain_freeze(2), icy_veins
0:27.291 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:28.343 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:29.394 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins
0:30.446 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:31.847 frostbolt Fluffy_Pillow 159380.2/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:33.248 frostfire_bolt Fluffy_Pillow 158760.5/160000: 99% mana bloodlust, brain_freeze, icy_veins
0:34.299 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:35.700 frostbolt Fluffy_Pillow 159380.2/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:37.101 frostfire_bolt Fluffy_Pillow 158760.5/160000: 99% mana bloodlust, brain_freeze
0:38.151 water_jet Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:38.151 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:39.552 frostbolt Fluffy_Pillow 159380.2/160000: 100% mana bloodlust
0:40.953 ice_lance Fluffy_Pillow 158760.5/160000: 99% mana bloodlust, fingers_of_frost
0:42.003 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
0:43.368 frostbolt Fluffy_Pillow 157932.1/160000: 99% mana
0:45.188 frostbolt Fluffy_Pillow 157308.2/160000: 98% mana
0:47.005 frostbolt Fluffy_Pillow 156674.8/160000: 98% mana
0:48.822 frostbolt Fluffy_Pillow 156041.4/160000: 98% mana
0:50.640 frostbolt Fluffy_Pillow 155411.1/160000: 97% mana
0:52.459 ice_nova Fluffy_Pillow 154784.1/160000: 97% mana
0:53.824 frostbolt Fluffy_Pillow 159116.2/160000: 99% mana
0:55.642 frostbolt Fluffy_Pillow 158485.9/160000: 99% mana
0:57.460 frostbolt Fluffy_Pillow 157855.7/160000: 99% mana
0:59.279 frostbolt Fluffy_Pillow 157228.6/160000: 98% mana enhanced_frostbolt
1:00.645 frozen_orb Fluffy_Pillow 155163.9/160000: 97% mana
1:02.009 ice_lance Fluffy_Pillow 143492.8/160000: 90% mana fingers_of_frost
1:03.375 frostbolt Fluffy_Pillow 146228.1/160000: 91% mana
1:05.194 ice_lance Fluffy_Pillow 145601.0/160000: 91% mana brain_freeze, fingers_of_frost
1:06.560 frostfire_bolt Fluffy_Pillow 148336.3/160000: 93% mana brain_freeze
1:07.928 frostbolt Fluffy_Pillow 152677.9/160000: 95% mana
1:09.747 frostbolt Fluffy_Pillow 152050.8/160000: 95% mana brain_freeze
1:11.565 frostfire_bolt Fluffy_Pillow 151420.6/160000: 95% mana brain_freeze
1:12.932 ice_lance Fluffy_Pillow 155759.0/160000: 97% mana fingers_of_frost
1:14.296 water_jet Fluffy_Pillow 158487.9/160000: 99% mana
1:14.296 frostbolt Fluffy_Pillow 158487.9/160000: 99% mana
1:16.114 frostbolt Fluffy_Pillow 157857.7/160000: 99% mana brain_freeze, enhanced_frostbolt
1:17.478 ice_nova Fluffy_Pillow 155786.6/160000: 97% mana brain_freeze, fingers_of_frost
1:18.844 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost(2)
1:20.209 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
1:21.575 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:22.940 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:24.761 frostbolt Fluffy_Pillow 159379.3/160000: 100% mana
1:26.580 frostbolt Fluffy_Pillow 158752.2/160000: 99% mana
1:28.399 frostbolt Fluffy_Pillow 158125.2/160000: 99% mana
1:30.217 frostbolt Fluffy_Pillow 157494.9/160000: 98% mana
1:32.035 frostbolt Fluffy_Pillow 156864.7/160000: 98% mana brain_freeze
1:33.854 frostfire_bolt Fluffy_Pillow 156237.6/160000: 98% mana brain_freeze
1:35.221 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
1:36.586 frostbolt Fluffy_Pillow 157932.1/160000: 99% mana
1:38.403 frostbolt Fluffy_Pillow 157298.7/160000: 98% mana brain_freeze
1:40.222 frostfire_bolt Fluffy_Pillow 156671.6/160000: 98% mana brain_freeze
1:41.588 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana
1:42.953 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
1:42.953 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:44.773 frostbolt Fluffy_Pillow 159376.1/160000: 100% mana
1:46.591 ice_lance Fluffy_Pillow 158745.9/160000: 99% mana brain_freeze, fingers_of_frost
1:47.957 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
1:49.322 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:50.689 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:52.507 frostbolt Fluffy_Pillow 159369.8/160000: 100% mana enhanced_frostbolt
1:53.873 frostbolt Fluffy_Pillow 157305.0/160000: 98% mana
1:55.693 frostbolt Fluffy_Pillow 156681.1/160000: 98% mana brain_freeze
1:57.510 frostfire_bolt Fluffy_Pillow 156047.7/160000: 98% mana brain_freeze
1:58.875 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:00.694 mirror_image Fluffy_Pillow 159372.9/160000: 100% mana
2:02.060 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana
2:03.424 ice_lance Fluffy_Pillow 148328.9/160000: 93% mana fingers_of_frost
2:04.788 frostbolt Fluffy_Pillow 151057.8/160000: 94% mana nightmare_fire
2:06.607 ice_nova Fluffy_Pillow 150430.8/160000: 94% mana nightmare_fire
2:07.972 frostbolt Fluffy_Pillow 154762.8/160000: 97% mana fingers_of_frost, nightmare_fire
2:09.790 ice_lance Fluffy_Pillow 154132.6/160000: 96% mana fingers_of_frost(2), nightmare_fire
2:11.155 ice_lance Fluffy_Pillow 156864.7/160000: 98% mana fingers_of_frost, nightmare_fire
2:12.521 water_jet Fluffy_Pillow 159600.0/160000: 100% mana nightmare_fire
2:12.521 frostbolt Fluffy_Pillow 159600.0/160000: 100% mana enhanced_frostbolt, nightmare_fire
2:13.888 frostbolt Fluffy_Pillow 157538.4/160000: 98% mana nightmare_fire
2:15.707 frostbolt Fluffy_Pillow 156911.3/160000: 98% mana fingers_of_frost, nightmare_fire
2:17.525 ice_lance Fluffy_Pillow 156281.1/160000: 98% mana brain_freeze, fingers_of_frost(2), nightmare_fire
2:18.892 frostfire_bolt Fluffy_Pillow 159019.5/160000: 99% mana brain_freeze, fingers_of_frost, nightmare_fire
2:20.258 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire
2:21.624 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:23.444 frostbolt Fluffy_Pillow 159376.1/160000: 100% mana fingers_of_frost, nightmare_fire
2:25.264 ice_lance Fluffy_Pillow 158752.2/160000: 99% mana fingers_of_frost
2:26.630 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:28.447 frostbolt Fluffy_Pillow 159366.6/160000: 100% mana
2:30.265 frostbolt Fluffy_Pillow 158736.4/160000: 99% mana enhanced_frostbolt
2:31.629 ice_nova Fluffy_Pillow 156665.3/160000: 98% mana
2:32.996 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:34.816 frostbolt Fluffy_Pillow 159376.1/160000: 100% mana
2:36.634 frostbolt Fluffy_Pillow 158745.9/160000: 99% mana brain_freeze, fingers_of_frost
2:38.452 frostfire_bolt Fluffy_Pillow 158115.6/160000: 99% mana brain_freeze(2), fingers_of_frost(2)
2:39.818 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost(2)
2:41.183 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
2:42.550 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:43.916 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
2:43.916 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:45.731 frostbolt Fluffy_Pillow 159360.2/160000: 100% mana
2:47.551 ice_lance Fluffy_Pillow 158736.4/160000: 99% mana fingers_of_frost
2:48.917 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, enhanced_frostbolt
2:50.282 ice_lance Fluffy_Pillow 157932.1/160000: 99% mana fingers_of_frost
2:51.648 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:53.467 frostbolt Fluffy_Pillow 159372.9/160000: 100% mana brain_freeze
2:55.287 frostfire_bolt Fluffy_Pillow 158749.1/160000: 99% mana brain_freeze(2)
2:56.653 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
2:58.020 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:59.839 frostbolt Fluffy_Pillow 159372.9/160000: 100% mana brain_freeze
3:01.656 icy_veins Fluffy_Pillow 158739.5/160000: 99% mana brain_freeze(2)
3:01.656 potion Fluffy_Pillow 158739.5/160000: 99% mana brain_freeze(2), icy_veins
3:01.656 ice_nova Fluffy_Pillow 158739.5/160000: 99% mana brain_freeze(2), icy_veins, draenic_intellect_potion
3:03.020 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze(2), icy_veins, draenic_intellect_potion
3:04.386 ice_lance Fluffy_Pillow 148335.3/160000: 93% mana brain_freeze(2), fingers_of_frost, icy_veins, draenic_intellect_potion
3:05.752 frostfire_bolt Fluffy_Pillow 151070.5/160000: 94% mana brain_freeze(2), icy_veins, draenic_intellect_potion
3:07.117 frostfire_bolt Fluffy_Pillow 155402.6/160000: 97% mana brain_freeze, icy_veins, draenic_intellect_potion
3:08.482 frostbolt Fluffy_Pillow 159734.7/160000: 100% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:09.847 frostbolt Fluffy_Pillow 157666.8/160000: 99% mana brain_freeze, icy_veins, draenic_intellect_potion
3:11.664 frostfire_bolt Fluffy_Pillow 157033.4/160000: 98% mana brain_freeze, icy_veins, draenic_intellect_potion
3:13.030 water_jet Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:13.030 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:14.850 ice_lance Fluffy_Pillow 159376.1/160000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:16.215 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:17.581 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, draenic_intellect_potion
3:19.398 frostbolt Fluffy_Pillow 159366.6/160000: 100% mana icy_veins, draenic_intellect_potion
3:21.217 frostbolt Fluffy_Pillow 158739.5/160000: 99% mana icy_veins, draenic_intellect_potion
3:23.037 ice_nova Fluffy_Pillow 158115.6/160000: 99% mana brain_freeze, icy_veins, draenic_intellect_potion
3:24.403 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, icy_veins, draenic_intellect_potion
3:25.768 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:27.133 frostbolt Fluffy_Pillow 157932.1/160000: 99% mana icy_veins
3:28.951 frostbolt Fluffy_Pillow 157301.8/160000: 98% mana
3:30.770 frostbolt Fluffy_Pillow 156674.8/160000: 98% mana
3:32.589 frostbolt Fluffy_Pillow 156047.7/160000: 98% mana brain_freeze
3:34.406 frostfire_bolt Fluffy_Pillow 155414.3/160000: 97% mana brain_freeze
3:35.771 frostbolt Fluffy_Pillow 159746.4/160000: 100% mana
3:37.590 frostbolt Fluffy_Pillow 159119.3/160000: 99% mana brain_freeze
3:39.408 frostfire_bolt Fluffy_Pillow 158489.1/160000: 99% mana brain_freeze, fingers_of_frost
3:40.773 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:42.139 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
3:42.139 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
3:43.505 frostbolt Fluffy_Pillow 157935.3/160000: 99% mana
3:45.322 ice_lance Fluffy_Pillow 157301.8/160000: 98% mana fingers_of_frost
3:46.689 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:48.053 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:49.418 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
3:51.238 frostbolt Fluffy_Pillow 159376.1/160000: 100% mana
3:53.056 frostbolt Fluffy_Pillow 158745.9/160000: 99% mana fingers_of_frost
3:54.875 ice_lance Fluffy_Pillow 158118.8/160000: 99% mana fingers_of_frost
3:56.240 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
3:58.060 frostbolt Fluffy_Pillow 159376.1/160000: 100% mana brain_freeze
3:59.879 frostfire_bolt Fluffy_Pillow 158749.1/160000: 99% mana brain_freeze
4:01.245 mirror_image Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:02.611 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt, nightmare_fire
4:03.976 frozen_orb Fluffy_Pillow 157932.1/160000: 99% mana nightmare_fire
4:05.340 ice_lance Fluffy_Pillow 146261.0/160000: 91% mana fingers_of_frost, nightmare_fire
4:06.705 frostbolt Fluffy_Pillow 148993.1/160000: 93% mana nightmare_fire
4:08.523 frostbolt Fluffy_Pillow 148362.8/160000: 93% mana brain_freeze, fingers_of_frost(2), nightmare_fire
4:10.341 ice_lance Fluffy_Pillow 147732.6/160000: 92% mana brain_freeze(2), fingers_of_frost(2), nightmare_fire
4:11.707 ice_lance Fluffy_Pillow 150467.9/160000: 94% mana brain_freeze(2), fingers_of_frost, nightmare_fire
4:13.073 ice_nova Fluffy_Pillow 153203.1/160000: 96% mana brain_freeze(2), nightmare_fire
4:14.438 frostfire_bolt Fluffy_Pillow 157535.2/160000: 98% mana brain_freeze(2), nightmare_fire
4:15.801 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, nightmare_fire
4:17.168 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2), nightmare_fire
4:18.534 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire
4:19.898 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
4:19.898 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
4:21.265 frostbolt Fluffy_Pillow 157938.4/160000: 99% mana brain_freeze
4:23.084 frostfire_bolt Fluffy_Pillow 157311.4/160000: 98% mana brain_freeze, fingers_of_frost
4:24.451 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2)
4:25.818 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:27.185 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:29.004 frostbolt Fluffy_Pillow 159372.9/160000: 100% mana
4:30.822 frostbolt Fluffy_Pillow 158742.7/160000: 99% mana
4:32.642 frostbolt Fluffy_Pillow 158118.8/160000: 99% mana brain_freeze
4:34.460 frostfire_bolt Fluffy_Pillow 157488.6/160000: 98% mana brain_freeze
4:35.825 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:37.642 ice_nova Fluffy_Pillow 159366.6/160000: 100% mana fingers_of_frost
4:39.010 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:40.375 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
4:41.742 frostbolt Fluffy_Pillow 157938.4/160000: 99% mana
4:43.561 frostbolt Fluffy_Pillow 157311.4/160000: 98% mana
4:45.378 frostbolt Fluffy_Pillow 156678.0/160000: 98% mana brain_freeze
4:47.196 frostfire_bolt Fluffy_Pillow 156047.7/160000: 98% mana brain_freeze(2)
4:48.562 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
4:49.927 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
4:49.927 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:51.746 frostbolt Fluffy_Pillow 159372.9/160000: 100% mana
4:53.565 ice_lance Fluffy_Pillow 158745.9/160000: 99% mana brain_freeze, fingers_of_frost
4:54.929 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
4:56.294 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:57.660 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
4:59.025 frostbolt Fluffy_Pillow 157932.1/160000: 99% mana
5:00.844 frostbolt Fluffy_Pillow 157305.0/160000: 98% mana

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 748 713 713
Agility 998 951 951
Stamina 4309 3918 3918
Intellect 4117 3658 3540 (2378)
Spirit 1157 1157 1157
Health 258540 235080 0
Mana 160000 160000 0
Spell Power 5688 4712 1054
Crit 14.55% 9.55% 501
Haste 10.20% 4.95% 495
Multistrike 33.56% 18.97% 1252
Damage / Heal Versatility 5.63% 2.63% 342
ManaReg per Second 3174 3023 0
Mastery 36.70% 26.70% 588
Armor 626 626 626
Run Speed 0 0 68

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Procrank"
origin="http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/182/59746230-avatar.jpg"
level=100
race=draenei
role=spell
position=back
professions=tailoring=640/inscription=691
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/water_elemental/splitting_ice/unbound_elemental/illusion/rapid_teleportation
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=ironburner_cowl,id=118964,bonus_id=233
neck=odyssian_choker,id=113833,bonus_id=566,enchant=75mult
shoulders=mantle_of_volatile_ice,id=114517,bonus_id=202/563,gems=35mult
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=42,enchant=gift_of_multistrike
chest=hexweave_robe,id=114813,bonus_id=136/525/538
shirt=sightless_mantle,id=98093
tabard=stormwind_tabard,id=118365
wrists=bracers_of_arcane_mystery,id=109864,bonus_id=524
hands=hexweave_gloves,id=114812,bonus_id=189/525/538
waist=cord_of_winsome_sorrows,id=119336,bonus_id=566
legs=seacursed_leggings,id=113828,bonus_id=566
feet=ironburner_sandals,id=118968,bonus_id=181
finger1=diamondglow_circle,id=109763,bonus_id=523/524,gems=35mult,enchant=30mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=30mult
trinket1=sandmans_pouch,id=112320,bonus_id=525/529
trinket2=grandiose_power,id=114550
main_hand=blackfire_spellblade,id=118984,bonus_id=220,enchant=mark_of_the_shattered_hand
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=3028
# gear_intellect=2378
# gear_spell_power=1054
# gear_crit_rating=501
# gear_haste_rating=495
# gear_mastery_rating=588
# gear_armor=626
# gear_multistrike_rating=1192
# gear_versatility_rating=342
# gear_speed_rating=68

Zentimeter

Zentimeter : 23006 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23006.0 23006.0 10.6 / 0.046% 3273.2 / 14.2% 6.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2819.5 2819.5 Mana 0.00% 43.5 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Splitting Ice
  • Glyph of Water Elemental
  • Glyph of Conjure Familiar
  • Glyph of Evaporation
  • Glyph of Momentum
Professions
  • tailoring: 680
  • enchanting: 655

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zentimeter+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:353056|34647|33383|30961|19059|10418&chds=0,706112&chco=69CCF0,9900CC,0070DE,0070DE,0070DE,0070DE&chm=t++353056++mirror_image,69CCF0,0,0,15|t++34647++frostfire_bolt,9900CC,1,0,15|t++33383++ice_nova,0070DE,2,0,15|t++30961++frozen_orb,0070DE,3,0,15|t++19059++ice_lance,0070DE,4,0,15|t++10418++frostbolt,0070DE,5,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:23,23,18,17,11,11,11,8,4,2,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,9900CC,0070DE,C79C6E,0070DE&chl=frostbolt|ice_lance|mirror_image: frostbolt|frostfire_bolt|water_elemental: waterbolt|icicle_fb|ice_nova|icicle_ffb|frozen_orb_bolt|shattered_bleed|water_elemental: water_jet&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zentimeter+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:ehjnruwz2565852454221zzywuutrqqpommkhfecbbbaYYWVVTSRRSSSSTTTTTSSSTUVVVVVUUTTTSSSSSSSSRQQQPPQSSSSSTTTTTSSSSSSSSSRQPQRSUVWWXXYZZabbcddefedcbaaaabbbbaaZZZZZYYYYYYYXWVUUTTSSSTTTTUUVWWXYZabbcdefgfghiihgfffeedccbbaaZYWUUUUVVVVVUUUTTTSSSSSSSRSRRSTTVWXYZZaabccdeeedddccbaZZZabaaZZZYYYYYYYXXXWWVUTSSSSTSSSSSSSSSTTTTTUUUUTTTTTTUUTTSSSSRRRRRRRRRRRQQQRRSSSSSSSSSSSSSSSSSTTUUUTTSRQQPONMM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.439615,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=23006|max=52332&chxp=1,1,44,100 http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zentimeter+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,2,6,9,27,44,68,125,161,243,317,433,547,722,861,918,1007,1141,1147,1200,1289,1321,1335,1392,1316,1300,1251,1175,1052,962,764,701,544,414,343,265,199,130,76,65,38,31,24,9,6,6,9,1,0,1&chds=0,1392&chbh=5&chxt=x&chxl=0:|min=20165|avg=23006|max=26437&chxp=0,1,45,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:57.3,21.3,12.4,5.7,2.4,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 172.4s|ice_lance 64.0s|frostfire_bolt 37.3s|ice_nova 17.1s|frozen_orb 7.3s|mirror_image 2.7s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zentimeter 23006
frostbolt 4063 (5977) 17.7% (26.0%) 105.5 2.82sec 17017 10418 Direct 105.3 8482 17134 9479 11.5% 76.2 2604 5293 12.0%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.55 105.30 0.00 0.00 1.6334 0.0000 1221085.14 1221085.14 0.00 10417.98 10417.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.17 12.04% 5293.25 4958 6093 5297.12 0 6093 48553 48553 0.00
multistrike 66.98 87.96% 2603.72 2479 3046 2605.36 2520 2724 174402 174402 0.00
hit 93.16 88.47% 8481.73 8264 10154 8485.44 8332 8693 790158 790158 0.00
crit 12.14 11.53% 17134.41 16527 20308 17147.25 16527 20308 207972 207972 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1140} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 1914 8.3% 179.4 1.97sec 3206 0 Direct 178.3 3225 0 3225 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.35 178.29 0.00 0.00 0.0000 0.0000 575005.74 575005.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.29 100.00% 3225.08 1143 15680 3226.57 2633 4231 575006 575006 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3636.00
  • base_dd_max:3636.00
 
frostfire_bolt 3001 (4314) 13.0% (18.7%) 29.4 9.92sec 43950 34647 Direct 29.3 14335 28971 24293 68.0% 24.7 4416 8962 68.8%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.40 29.34 0.00 0.00 1.2685 0.0000 898875.64 898875.64 0.00 34647.15 34647.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.98 68.85% 8961.83 8305 10205 8968.61 8305 9968 152135 152135 0.00
multistrike 7.68 31.15% 4416.04 4152 5103 4417.77 0 5103 33924 33924 0.00
hit 9.38 31.96% 14335.29 13841 17008 14343.78 0 17008 134455 134455 0.00
crit 19.96 68.04% 28970.92 27682 34017 28994.81 27682 32116 578361 578361 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=1516}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1313 5.7% 53.4 5.70sec 7360 0 Direct 53.2 7395 0 7395 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.45 53.20 0.00 0.00 0.0000 0.0000 393359.13 393359.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.20 100.00% 7394.58 1143 15680 7408.36 5298 9703 393359 393359 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3636.00
  • base_dd_max:3636.00
 
frozen_orb 0 (752) 0.0% (3.3%) 5.4 60.94sec 41408 30961

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.44 5.44 53.30 53.30 1.3375 1.0000 0.00 0.00 0.00 3717.99 30961.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.6 85.48% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.7 14.52% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=367} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 752 3.3% 0.0 0.00sec 0 0 Direct 53.3 2889 5767 3305 14.5% 47.1 910 1818 14.4%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.30 0.00 0.00 0.0000 0.0000 225213.50 225213.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.79 14.40% 1817.57 1596 1961 1817.36 0 1961 12335 12335 0.00
multistrike 40.34 85.60% 910.21 798 981 911.33 863 974 36716 36716 0.00
hit 45.60 85.55% 2889.09 2660 3268 2892.94 2802 3051 131732 131732 0.00
crit 7.70 14.45% 5767.45 5320 6537 5771.82 0 6537 44431 44431 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=367} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 4067 17.7% 49.7 6.02sec 24533 19059 Direct 49.6 11623 23388 19721 68.8% 39.2 3623 7305 69.5%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.75 49.58 0.00 0.00 1.2872 0.0000 1220456.53 1220456.53 0.00 19058.62 19058.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.28 69.52% 7305.39 6660 8184 7313.04 6782 8075 199310 199310 0.00
multistrike 11.96 30.48% 3622.61 3330 4092 3626.51 3330 4092 43326 43326 0.00
hit 15.46 31.17% 11623.36 11100 13640 11632.92 11100 13005 179640 179640 0.00
crit 34.13 68.83% 23388.17 22199 27279 23408.58 22199 24873 798180 798180 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=382}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 1901 8.3% 13.4 23.09sec 42362 33383 Direct 13.4 29625 59511 33245 12.1% 11.8 9251 18628 12.3%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.45 13.45 0.00 0.00 1.2690 0.0000 569648.76 569648.76 0.00 33383.07 33383.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.45 12.28% 18627.61 16651 20461 14501.74 0 20461 26953 26953 0.00
multistrike 10.34 87.72% 9250.88 8326 10230 9269.95 8326 10230 95643 95643 0.00
hit 11.82 87.89% 29624.70 27752 34101 29651.27 27752 31985 350118 350118 0.00
crit 1.63 12.11% 59510.60 55504 68203 49037.33 0 68203 96936 96936 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=1913} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (3158) 0.0% (13.7%) 3.0 120.92sec 314859 353056

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.8919 0.0000 0.00 0.00 0.00 353056.13 353056.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.64 88.05% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.36 11.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 8490 13.7% 201.9 4.06sec 4680 2901 Direct 201.0 3190 6489 3709 15.7% 173.2 985 2018 16.3%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.93 200.96 0.00 0.00 1.6135 0.0000 945131.27 945131.27 0.00 2900.73 2900.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 28.21 16.28% 2018.19 1831 2251 2019.61 1848 2191 56927 56927 0.00
multistrike 145.02 83.72% 985.32 916 1125 985.96 960 1027 142894 142894 0.00
hit 169.34 84.27% 3189.80 3052 3751 3191.99 3141 3274 540165 540165 0.00
crit 31.62 15.73% 6488.82 6105 7502 6495.25 6105 7091 205145 205145 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 435 1.9% 17.2 17.82sec 7585 0 Direct 17.2 1571 3143 1757 11.8% 12.8 471 943 12.3%  
Periodic 97.3 778 0 778 0.0% 76.2 236 0 0.0% 32.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.23 17.23 97.26 97.26 0.0000 1.0000 130677.24 130677.24 0.00 1343.55 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.57 12.27% 942.85 943 943 739.69 0 943 1478 1478 0.00
multistrike 11.21 87.73% 471.43 471 471 471.43 471 471 5285 5285 0.00
hit 15.19 88.18% 1571.42 1571 1571 1571.42 1571 1571 23873 23873 0.00
crit 2.04 11.82% 3142.85 3143 3143 2741.06 0 3143 6397 6397 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 76.2 100.00% 235.71 236 236 235.71 236 236 17967 17967 0.00
hit 97.3 100.00% 778.07 1 786 778.30 753 786 75677 75677 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - water_elemental 2402 / 2402
water_jet 405 1.8% 10.0 30.31sec 12177 2882 Periodic 39.7 2207 4467 2492 12.6% 29.0 690 1402 13.4% 11.2%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 10.01 39.75 39.75 4.2247 0.8498 121837.40 121837.40 0.00 2882.43 2882.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.9 13.35% 1402.38 1268 1558 1380.15 0 1558 5435 5435 0.00
multistrike 25.2 86.65% 690.01 634 779 691.17 647 753 17356 17356 0.00
hit 34.7 87.38% 2206.77 2113 2596 2208.54 2137 2281 76638 76638 0.00
crit 5.0 12.62% 4466.52 4226 5193 4446.85 0 5193 22408 22408 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 1997 8.7% 116.0 2.58sec 5167 2408 Direct 115.1 3754 7582 4205 11.8% 88.6 1158 2351 12.2%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.05 115.11 0.00 0.00 2.1458 0.0000 599643.13 599643.13 0.00 2408.05 2408.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.85 12.25% 2351.10 2180 2679 2353.00 2180 2679 25509 25509 0.00
multistrike 77.75 87.75% 1158.29 1090 1340 1159.08 1122 1209 90055 90055 0.00
hit 101.54 88.21% 3754.08 3634 4465 3756.04 3696 3831 381199 381199 0.00
crit 13.57 11.79% 7582.21 7268 8930 7587.67 7268 8598 102880 102880 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=464} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 8490 / 3158
frostbolt 8490 13.7% 201.9 4.06sec 4680 2901 Direct 201.0 3190 6489 3709 15.7% 173.2 985 2018 16.3%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.93 200.96 0.00 0.00 1.6135 0.0000 945131.27 945131.27 0.00 2900.73 2900.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 28.21 16.28% 2018.19 1831 2251 2019.61 1848 2191 56927 56927 0.00
multistrike 145.02 83.72% 985.32 916 1125 985.96 960 1027 142894 142894 0.00
hit 169.34 84.27% 3189.80 3052 3751 3191.99 3141 3274 540165 540165 0.00
crit 31.62 15.73% 6488.82 6105 7502 6495.25 6105 7091 205145 205145 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Zentimeter
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 180.96sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 2.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.84 89.54% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.22 10.46% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.90 90.48% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.10 9.52% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 24.2 5.4 12.3sec 10.0sec 19.12% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:18.53%
  • brain_freeze_2:0.59%

Trigger Attempt Success

  • trigger_pct:28.24%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.7sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.7 0.0 17.4sec 18.2sec 7.12% 16.76% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 35.5 16.5 8.5sec 5.8sec 30.24% 100.00% 1.9(1.9)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:25.93%
  • fingers_of_frost_2:4.31%

Trigger Attempt Success

  • trigger_pct:24.66%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.8sec 181.0sec 22.73% 24.81% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
nightmare_fire 2.9 0.0 121.5sec 121.3sec 18.97% 18.99% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zentimeter
frostbolt Mana 105.5 675514.8 6400.0 6400.0 2.7
frozen_orb Mana 5.4 87021.6 16000.0 15999.8 2.6
ice_lance Mana 49.7 79597.5 1600.0 1600.0 15.3
mirror_image Mana 3.0 6405.6 2134.0 2134.0 147.5
Resource Gains Type Count Total Average Overflow
external_healing Health 8.40 0.00 (0.00%) 0.00 78096.52 100.00%
mp5_regen Mana 204.15 844909.54 (100.00%) 4138.62 166440.28 16.46%
Resource RPS-Gain RPS-Loss
Mana 2807.44 2819.50
Combat End Resource Mean Min Max
Mana 164385.78 144906.25 168000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 21.0%
water_elemental-Mana Cap 21.0%
prismatic_crystal-Mana Cap 21.0%
mirror_image-Mana Cap 21.0%
mirror_image-Mana Cap 21.0%
mirror_image-Mana Cap 21.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zentimeter Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Zentimeter Damage Per Second
Count 25000
Mean 23006.04
Minimum 20164.95
Maximum 26437.24
Spread ( max - min ) 6272.29
Range [ ( max - min ) / 2 * 100% ] 13.63%
Standard Deviation 858.3848
5th Percentile 21616.43
95th Percentile 24415.05
( 95th Percentile - 5th Percentile ) 2798.62
Mean Distribution
Standard Deviation 5.4289
95.00% Confidence Intervall ( 22995.40 - 23016.68 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5347
0.1 Scale Factor Error with Delta=300 6289
0.05 Scale Factor Error with Delta=300 25159
0.01 Scale Factor Error with Delta=300 628995
Distribution Chart
DPS(e)
Sample Data Zentimeter Damage Per Second (Effective)
Count 25000
Mean 23006.04
Minimum 20164.95
Maximum 26437.24
Spread ( max - min ) 6272.29
Range [ ( max - min ) / 2 * 100% ] 13.63%
Damage
Sample Data Zentimeter Damage
Count 25000
Mean 5234321.68
Minimum 3782474.96
Maximum 6706928.58
Spread ( max - min ) 2924453.61
Range [ ( max - min ) / 2 * 100% ] 27.94%
DTPS
Sample Data Zentimeter Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zentimeter Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Zentimeter Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zentimeter Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zentimeter Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zentimeter Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ZentimeterTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Zentimeter Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.00 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.06 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.00 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.44 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.17 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 21.98 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 29.40 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 27.77 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.03 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 105.11 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678XnpqszzzzttxyzztqtxzzxtxzstzxtxzztxzyzzqxzzzzzstzzznqqzzzzyzzzqsxzzzztzzzzxtyzzsqxzzzxtzzztDnqzzqqqqsyzztqtxzzzttzstxzzzttqxyzzxxzzzztXbsnqqtzzqtyzzxzxszztxzzzztxzyztxzstxzzzttxzDnqzzzqstxyzztxxzztxzzztzszzyztxzzzxxzztzz

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana
Pre food Fluffy_Pillow 168000.0/168000: 100% mana
Pre water_elemental Fluffy_Pillow 168000.0/168000: 100% mana
Pre mirror_image Fluffy_Pillow 168000.0/168000: 100% mana
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 161600.0/168000: 96% mana draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 161600.0/168000: 96% mana draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 161600.0/168000: 96% mana icy_veins, draenic_intellect_potion
0:01.337 ice_nova Fluffy_Pillow 151228.7/168000: 90% mana bloodlust, fingers_of_frost, icy_veins, draenic_intellect_potion
0:02.369 ice_lance Fluffy_Pillow 155573.3/168000: 93% mana bloodlust, fingers_of_frost, icy_veins, draenic_intellect_potion
0:03.400 ice_nova Fluffy_Pillow 158313.8/168000: 94% mana bloodlust, icy_veins, draenic_intellect_potion
0:04.431 frostbolt Fluffy_Pillow 162654.2/168000: 97% mana bloodlust, icy_veins, enhanced_frostbolt, draenic_intellect_potion
0:05.460 frostbolt Fluffy_Pillow 160586.2/168000: 96% mana bloodlust, icy_veins, draenic_intellect_potion
0:06.832 frostbolt Fluffy_Pillow 159962.3/168000: 95% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:08.206 frostbolt Fluffy_Pillow 159346.7/168000: 95% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:09.578 frostfire_bolt Fluffy_Pillow 158722.7/168000: 94% mana bloodlust, brain_freeze(2), fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.610 frostfire_bolt Fluffy_Pillow 163067.4/168000: 97% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.639 ice_lance Fluffy_Pillow 167399.4/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.669 water_jet Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.669 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:14.042 frostbolt Fluffy_Pillow 167380.2/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:15.415 frostfire_bolt Fluffy_Pillow 166760.5/168000: 99% mana bloodlust, brain_freeze(2), fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:16.446 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:17.476 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:18.506 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:19.537 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:20.910 frostbolt Fluffy_Pillow 167380.2/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, enhanced_frostbolt, nightmare_fire
0:21.942 ice_lance Fluffy_Pillow 165324.9/168000: 98% mana bloodlust, brain_freeze, fingers_of_frost(2), icy_veins, nightmare_fire
0:22.972 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire
0:24.002 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire
0:25.034 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, nightmare_fire
0:26.407 ice_nova Fluffy_Pillow 167380.2/168000: 100% mana bloodlust, brain_freeze, icy_veins, nightmare_fire
0:27.439 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:28.470 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins
0:29.842 ice_lance Fluffy_Pillow 167376.0/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins
0:30.874 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:31.906 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins
0:32.937 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins
0:34.310 frostbolt Fluffy_Pillow 167380.2/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:35.681 frostfire_bolt Fluffy_Pillow 166752.1/168000: 99% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins
0:36.712 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost
0:37.742 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, enhanced_frostbolt
0:38.774 water_jet Fluffy_Pillow 165944.7/168000: 99% mana bloodlust
0:38.774 frostbolt Fluffy_Pillow 165944.7/168000: 99% mana bloodlust
0:40.146 frostbolt Fluffy_Pillow 165320.7/168000: 98% mana bloodlust, fingers_of_frost
0:41.518 ice_lance Fluffy_Pillow 163363.8/168000: 97% mana fingers_of_frost(2)
0:42.855 ice_lance Fluffy_Pillow 166093.5/168000: 99% mana fingers_of_frost
0:44.192 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
0:45.975 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana
0:47.756 frostbolt Fluffy_Pillow 166741.7/168000: 99% mana
0:49.539 frostbolt Fluffy_Pillow 166115.8/168000: 99% mana
0:51.321 frostbolt Fluffy_Pillow 165486.6/168000: 99% mana
0:53.103 ice_nova Fluffy_Pillow 164857.5/168000: 98% mana brain_freeze
0:54.439 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
0:55.775 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
0:57.113 frostbolt Fluffy_Pillow 165933.0/168000: 99% mana
0:58.896 frostbolt Fluffy_Pillow 165307.1/168000: 98% mana
1:00.678 frozen_orb Fluffy_Pillow 164677.9/168000: 98% mana
1:02.016 ice_lance Fluffy_Pillow 153010.9/168000: 91% mana fingers_of_frost
1:03.353 ice_lance Fluffy_Pillow 155740.7/168000: 93% mana fingers_of_frost
1:04.688 frostbolt Fluffy_Pillow 158464.0/168000: 94% mana
1:06.472 frostbolt Fluffy_Pillow 157841.3/168000: 94% mana
1:08.256 frostbolt Fluffy_Pillow 157218.6/168000: 94% mana
1:10.040 frostbolt Fluffy_Pillow 156595.9/168000: 93% mana
1:11.824 water_jet Fluffy_Pillow 155973.3/168000: 93% mana
1:11.824 frostbolt Fluffy_Pillow 155973.3/168000: 93% mana
1:13.607 frostbolt Fluffy_Pillow 155347.3/168000: 92% mana enhanced_frostbolt
1:14.945 frostbolt Fluffy_Pillow 153280.3/168000: 91% mana fingers_of_frost
1:16.727 ice_lance Fluffy_Pillow 152651.2/168000: 91% mana fingers_of_frost(2)
1:18.065 ice_nova Fluffy_Pillow 155384.2/168000: 92% mana fingers_of_frost
1:19.403 ice_lance Fluffy_Pillow 159717.2/168000: 95% mana fingers_of_frost
1:20.740 frostbolt Fluffy_Pillow 162446.9/168000: 97% mana
1:22.522 frostbolt Fluffy_Pillow 161817.8/168000: 96% mana
1:24.303 frostbolt Fluffy_Pillow 161185.4/168000: 96% mana
1:26.085 frostbolt Fluffy_Pillow 160556.2/168000: 96% mana brain_freeze
1:27.866 frostfire_bolt Fluffy_Pillow 159923.8/168000: 95% mana brain_freeze
1:29.203 frostbolt Fluffy_Pillow 164253.6/168000: 98% mana
1:30.987 frostbolt Fluffy_Pillow 163630.9/168000: 97% mana enhanced_frostbolt
1:32.325 frostbolt Fluffy_Pillow 161563.9/168000: 96% mana
1:34.109 frostbolt Fluffy_Pillow 160941.2/168000: 96% mana fingers_of_frost
1:35.890 ice_lance Fluffy_Pillow 160308.8/168000: 95% mana brain_freeze, fingers_of_frost
1:37.227 frostfire_bolt Fluffy_Pillow 163038.6/168000: 97% mana brain_freeze
1:38.565 water_jet Fluffy_Pillow 167371.6/168000: 100% mana
1:38.565 frostbolt Fluffy_Pillow 167371.6/168000: 100% mana
1:40.348 frostbolt Fluffy_Pillow 166745.7/168000: 99% mana
1:42.131 ice_nova Fluffy_Pillow 166119.8/168000: 99% mana fingers_of_frost
1:43.469 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
1:44.807 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
1:46.143 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:47.924 frostbolt Fluffy_Pillow 167367.6/168000: 100% mana enhanced_frostbolt
1:49.261 frostbolt Fluffy_Pillow 165297.4/168000: 98% mana fingers_of_frost
1:51.042 ice_lance Fluffy_Pillow 164665.0/168000: 98% mana brain_freeze, fingers_of_frost
1:52.380 frostfire_bolt Fluffy_Pillow 167398.0/168000: 100% mana brain_freeze
1:53.717 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:55.499 frostbolt Fluffy_Pillow 167370.8/168000: 100% mana
1:57.281 frostbolt Fluffy_Pillow 166741.7/168000: 99% mana brain_freeze
1:59.065 frostfire_bolt Fluffy_Pillow 166119.0/168000: 99% mana brain_freeze
2:00.403 mirror_image Fluffy_Pillow 168000.0/168000: 100% mana
2:01.742 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana
2:03.080 ice_lance Fluffy_Pillow 156333.0/168000: 93% mana fingers_of_frost
2:04.415 frostbolt Fluffy_Pillow 159056.3/168000: 95% mana enhanced_frostbolt
2:05.754 frostbolt Fluffy_Pillow 156992.5/168000: 93% mana fingers_of_frost
2:07.538 ice_lance Fluffy_Pillow 156369.8/168000: 93% mana fingers_of_frost
2:08.875 ice_lance Fluffy_Pillow 159099.6/168000: 95% mana fingers_of_frost(2), nightmare_fire
2:10.213 ice_lance Fluffy_Pillow 161832.6/168000: 96% mana fingers_of_frost(2), nightmare_fire
2:11.551 ice_lance Fluffy_Pillow 164565.6/168000: 98% mana fingers_of_frost, nightmare_fire
2:12.889 ice_nova Fluffy_Pillow 167298.6/168000: 100% mana nightmare_fire
2:14.226 water_jet Fluffy_Pillow 168000.0/168000: 100% mana nightmare_fire
2:14.226 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana nightmare_fire
2:16.009 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana brain_freeze, nightmare_fire
2:17.791 frostfire_bolt Fluffy_Pillow 166744.9/168000: 99% mana brain_freeze(2), fingers_of_frost, nightmare_fire
2:19.127 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost(2), nightmare_fire
2:20.464 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, nightmare_fire
2:21.802 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
2:23.140 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, nightmare_fire
2:24.478 frostbolt Fluffy_Pillow 165933.0/168000: 99% mana nightmare_fire
2:26.260 frostbolt Fluffy_Pillow 165303.8/168000: 98% mana brain_freeze, nightmare_fire
2:28.043 frostfire_bolt Fluffy_Pillow 164677.9/168000: 98% mana brain_freeze(2), nightmare_fire
2:29.380 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
2:30.720 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:32.504 ice_nova Fluffy_Pillow 167377.3/168000: 100% mana brain_freeze, fingers_of_frost
2:33.841 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost
2:35.178 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:36.515 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:38.298 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana
2:40.081 frostbolt Fluffy_Pillow 166748.2/168000: 99% mana brain_freeze, fingers_of_frost, enhanced_frostbolt
2:41.417 frostfire_bolt Fluffy_Pillow 164674.7/168000: 98% mana brain_freeze(2), fingers_of_frost
2:42.755 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost
2:44.092 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
2:45.432 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:46.770 water_jet Fluffy_Pillow 168000.0/168000: 100% mana
2:46.770 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:48.553 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana
2:50.334 ice_lance Fluffy_Pillow 166741.7/168000: 99% mana fingers_of_frost
2:51.672 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:53.010 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:54.794 frostbolt Fluffy_Pillow 167377.3/168000: 100% mana
2:56.578 frostbolt Fluffy_Pillow 166754.6/168000: 99% mana fingers_of_frost, enhanced_frostbolt
2:57.916 frostbolt Fluffy_Pillow 164687.6/168000: 98% mana brain_freeze, fingers_of_frost
2:59.699 frostfire_bolt Fluffy_Pillow 164061.7/168000: 98% mana brain_freeze(2), fingers_of_frost
3:01.036 icy_veins Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost
3:01.036 potion Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins
3:01.036 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:02.373 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:03.710 ice_lance Fluffy_Pillow 156329.8/168000: 93% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:05.047 ice_lance Fluffy_Pillow 159059.5/168000: 95% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:06.385 frostfire_bolt Fluffy_Pillow 161792.5/168000: 96% mana brain_freeze, icy_veins, draenic_intellect_potion
3:07.723 frostbolt Fluffy_Pillow 166125.5/168000: 99% mana icy_veins, draenic_intellect_potion
3:09.506 frostbolt Fluffy_Pillow 165499.6/168000: 99% mana brain_freeze, icy_veins, draenic_intellect_potion
3:11.289 ice_lance Fluffy_Pillow 164873.7/168000: 98% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:12.628 frostfire_bolt Fluffy_Pillow 167609.9/168000: 100% mana brain_freeze, icy_veins, draenic_intellect_potion
3:13.965 water_jet Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:13.965 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:15.304 frostbolt Fluffy_Pillow 165936.2/168000: 99% mana icy_veins, draenic_intellect_potion
3:17.087 ice_lance Fluffy_Pillow 165310.3/168000: 98% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:18.423 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:20.205 ice_lance Fluffy_Pillow 167370.8/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:21.543 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:22.882 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:24.664 frostbolt Fluffy_Pillow 167370.8/168000: 100% mana brain_freeze, icy_veins, draenic_intellect_potion
3:26.446 frostfire_bolt Fluffy_Pillow 166741.7/168000: 99% mana brain_freeze, icy_veins
3:27.784 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins
3:29.123 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins
3:30.907 frostbolt Fluffy_Pillow 167377.3/168000: 100% mana icy_veins, enhanced_frostbolt
3:32.244 frostbolt Fluffy_Pillow 165307.1/168000: 98% mana icy_veins
3:34.026 frostbolt Fluffy_Pillow 164677.9/168000: 98% mana brain_freeze
3:35.808 frostfire_bolt Fluffy_Pillow 164048.8/168000: 98% mana brain_freeze, fingers_of_frost
3:37.145 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:38.481 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:40.264 water_jet Fluffy_Pillow 167374.1/168000: 100% mana brain_freeze
3:40.264 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana brain_freeze
3:42.046 frostfire_bolt Fluffy_Pillow 166744.9/168000: 99% mana brain_freeze
3:43.382 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:44.719 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:46.502 ice_nova Fluffy_Pillow 167374.1/168000: 100% mana brain_freeze
3:47.839 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
3:49.178 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:50.517 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
3:51.856 frostbolt Fluffy_Pillow 165936.2/168000: 99% mana
3:53.638 frostbolt Fluffy_Pillow 165307.1/168000: 98% mana brain_freeze
3:55.421 frostfire_bolt Fluffy_Pillow 164681.2/168000: 98% mana brain_freeze(2)
3:56.760 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
3:58.098 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:59.434 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:01.216 mirror_image Fluffy_Pillow 167370.8/168000: 100% mana
4:02.553 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana
4:03.892 ice_lance Fluffy_Pillow 156336.2/168000: 93% mana fingers_of_frost
4:05.229 frostbolt Fluffy_Pillow 159066.0/168000: 95% mana
4:07.012 frostbolt Fluffy_Pillow 158440.1/168000: 94% mana enhanced_frostbolt
4:08.349 frostbolt Fluffy_Pillow 156369.8/168000: 93% mana brain_freeze
4:10.134 ice_lance Fluffy_Pillow 155750.4/168000: 93% mana brain_freeze, fingers_of_frost
4:11.472 ice_nova Fluffy_Pillow 158483.4/168000: 94% mana brain_freeze
4:12.809 frostfire_bolt Fluffy_Pillow 162813.1/168000: 97% mana brain_freeze, fingers_of_frost
4:14.146 ice_lance Fluffy_Pillow 167142.9/168000: 99% mana fingers_of_frost
4:15.482 water_jet Fluffy_Pillow 168000.0/168000: 100% mana
4:15.482 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:17.265 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana brain_freeze
4:19.048 frostfire_bolt Fluffy_Pillow 166748.2/168000: 99% mana brain_freeze, fingers_of_frost
4:20.386 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
4:21.724 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
4:23.064 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:24.848 frostbolt Fluffy_Pillow 167377.3/168000: 100% mana brain_freeze, fingers_of_frost, enhanced_frostbolt
4:26.186 frostfire_bolt Fluffy_Pillow 165310.3/168000: 98% mana brain_freeze, fingers_of_frost
4:27.525 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
4:28.862 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:30.645 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana
4:32.429 frostbolt Fluffy_Pillow 166751.4/168000: 99% mana brain_freeze
4:34.211 frostfire_bolt Fluffy_Pillow 166122.3/168000: 99% mana brain_freeze
4:35.548 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:37.328 ice_nova Fluffy_Pillow 167364.4/168000: 100% mana
4:38.666 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:40.449 frostbolt Fluffy_Pillow 167374.1/168000: 100% mana
4:42.231 water_jet Fluffy_Pillow 166744.9/168000: 99% mana brain_freeze
4:42.231 frostbolt Fluffy_Pillow 166744.9/168000: 99% mana brain_freeze, enhanced_frostbolt
4:43.570 frostfire_bolt Fluffy_Pillow 164681.2/168000: 98% mana brain_freeze, nightmare_fire
4:44.908 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
4:46.246 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana nightmare_fire
4:48.030 frostbolt Fluffy_Pillow 167377.3/168000: 100% mana nightmare_fire
4:49.811 frostbolt Fluffy_Pillow 166744.9/168000: 99% mana fingers_of_frost, nightmare_fire
4:51.593 ice_lance Fluffy_Pillow 166115.8/168000: 99% mana fingers_of_frost(2), nightmare_fire
4:52.931 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
4:54.269 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana nightmare_fire
4:56.054 frostbolt Fluffy_Pillow 167380.6/168000: 100% mana brain_freeze, nightmare_fire
4:57.836 frostfire_bolt Fluffy_Pillow 166751.4/168000: 99% mana brain_freeze, nightmare_fire
4:59.171 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, nightmare_fire
5:00.509 frostbolt Fluffy_Pillow 165933.0/168000: 99% mana nightmare_fire

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 674 642 642
Agility 935 891 891
Stamina 4066 3697 3697
Intellect 3860 3414 3304 (2207)
Spirit 1155 1155 1155
Health 243960 221820 0
Mana 168000 168000 0
Spell Power 5298 4370 956
Crit 12.42% 7.42% 266
Haste 12.44% 7.09% 603
Multistrike 27.26% 12.67% 836
Damage / Heal Versatility 4.76% 1.76% 229
ManaReg per Second 3238 3084 0
Mastery 44.00% 34.00% 990
Armor 606 606 606

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Zentimeter"
origin="http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/110/70512494-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=680/enchanting=655
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/splitting_ice/water_elemental/conjure_familiar/evaporation/momentum
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=vilebreath_mask,id=113596
neck=cratermaker_choker,id=116285,enchant=75mult
shoulders=slaughterhouse_spaulders,id=113609
back=kyusys_tarflame_doomcloak,id=119346,enchant=gift_of_multistrike
chest=hexweave_robe,id=114813,bonus_id=195/525/538
tabard=stormwind_tabard,id=118365
wrists=crystalwoven_bracers,id=113642
hands=sterilized_handwraps,id=115998,bonus_id=563,gems=35mult
waist=hexweave_belt,id=114816,bonus_id=184/525/538
legs=trousers_of_arcane_mystery,id=109804,bonus_id=524
feet=felflame_sandals,id=109797,bonus_id=524
finger1=diamondglow_circle,id=109763,bonus_id=524,enchant=30mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
trinket1=sandmans_pouch,id=112320,bonus_id=525/530
trinket2=tovras_lightning_repository,id=110001,bonus_id=524
main_hand=dagger_of_the_sanguine_emeralds,id=110050,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=interlopers_mossy_skull,id=119176,bonus_id=43/524

# Gear Summary
# gear_stamina=2807
# gear_intellect=2207
# gear_spell_power=956
# gear_crit_rating=266
# gear_haste_rating=603
# gear_mastery_rating=990
# gear_armor=606
# gear_multistrike_rating=796
# gear_versatility_rating=229

Zambo

Zambo : 25934 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
25933.8 25933.8 11.3 / 0.044% 3560.0 / 13.7% 75.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
342.2 342.2 Mana 1.60% 47.6 100.0% 100%
Origin http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced
Talents
  • 15: Pursuit of Justice
  • 30: Fist of Justice
  • 45: Selfless Healer
  • 60: Unbreakable Spirit
  • 75: Divine Purpose
  • 90: Execution Sentence
  • 100: Final Verdict (Retribution Paladin)
  • Talent Calculator
Glyphs
  • Glyph of Divine Storm
  • Glyph of Templar's Verdict
  • Glyph of Divine Protection
  • Glyph of Bladed Judgment
  • Glyph of Fire From the Heavens
  • Glyph of Winged Vengeance
Professions
  • mining: 700
  • blacksmithing: 692

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zambo+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:51814|20280|19656|15509|9083|9006|6526|2463&chds=0,103627&chco=FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++51814++execution_sentence,FFE57F,0,0,15|t++20280++final_verdict,FFE57F,1,0,15|t++19656++divine_storm,FFE57F,2,0,15|t++15509++hammer_of_wrath,FFE57F,3,0,15|t++9083++judgment,FFE57F,4,0,15|t++9006++exorcism,FFE57F,5,0,15|t++6526++crusader_strike,C79C6E,6,0,15|t++2463++melee,C79C6E,7,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:26,22,9,8,7,7,6,5,5,3,2,1&chds=0,100&chdls=ffffff&chco=FFE57F,FFE57F,C79C6E,FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F&chl=hand_of_light|final_verdict|melee|hammer_of_wrath|crusader_strike|divine_storm|judgment|seal_of_truth_proc|execution_sentence|censure|shattered_bleed|exorcism&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zambo+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gilosuw0367656310zxvrrpommljigfgfffededccccbbaaaZZYYXYYYZZZabbbbbbcbbbccdcbcbbbbZYZZZZYZZYYZYYZYYZYYYZYYZYYZZZZXYabcefghkmmopprrsuuwxvtsrqpomjjhggfeecbbaaaZZaZZZaZZaaaaaaaaYZZZaaaabcddddeddeeegfffeeeedddccccccccdccdccdddddddddddddddcccdeeefgghkjjkkklllnnnnmllljjigggfffeeedddddddddddddddddddddcbccdccdddfffgffgfffgghggggfffdddddddddcddcdddddddddcddccdcccbbbcbbcbcecaZYWVTSRP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.535371,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=25934|max=48441&chxp=1,1,54,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zambo+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,7,10,26,54,77,105,185,239,412,511,622,781,956,1171,1323,1475,1498,1564,1598,1481,1502,1371,1284,1187,1006,851,823,649,510,418,343,256,188,158,113,82,47,36,28,20,14,5,3,1,2,2,0,1,1&chds=0,1598&chbh=5&chxt=x&chxl=0:|min=23008|avg=25934|max=30232&chxp=0,1,41,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:28.2,26.1,16.5,12.9,8.6,3.9,2.4,1.6&chds=0,100&chdls=ffffff&chco=FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=final_verdict 85.0s|crusader_strike 78.6s|judgment 49.8s|hammer_of_wrath 38.7s|divine_storm 25.9s|exorcism 11.6s|execution_sentence 7.2s|waiting 4.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zambo 25934
censure 730 2.8% 297.2 1.01sec 739 0 Periodic 99.4 1818 3649 2050 12.7% 25.8 546 1095 12.7% 99.1%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 297.17 297.17 99.37 99.37 0.0000 3.0000 219607.29 219607.29 0.00 736.68 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 297.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.3 12.73% 1094.75 1017 1507 1051.06 0 1507 3595 3595 0.00
multistrike 22.5 87.27% 545.56 509 753 546.04 509 631 12279 12279 0.00
hit 86.8 87.33% 1818.30 1695 2511 1819.77 1754 1872 157788 157788 0.00
crit 12.6 12.67% 3649.00 3390 5022 3652.37 3390 4696 45945 45945 0.00
 
DPS Timeline Chart
 

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.061776
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
crusader_strike 1705 6.6% 62.0 4.83sec 8276 6526 Direct 62.0 6814 13697 7679 12.6% 16.1 2045 4104 12.5%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.99 61.99 0.00 0.00 1.2683 0.0000 513019.76 788430.37 34.93 6525.56 6525.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.02 12.55% 4103.94 3847 5469 3536.59 0 5469 8272 12713 30.09
multistrike 14.05 87.45% 2044.80 1923 2734 2046.18 1923 2442 28729 44152 34.93
hit 54.20 87.43% 6814.02 6411 9115 6818.76 6508 7101 369289 567539 34.93
crit 7.79 12.57% 13696.91 12822 18230 13704.42 0 18230 106730 164027 34.91
 
DPS Timeline Chart
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:640.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}|s85256[An instant strike that causes $sw2 Physical damage and grants 1 Holy Power.][An instant strike that causes $sw2 Physical damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
divine_storm 1696 6.5% 20.3 13.94sec 25068 19656 Direct 20.3 20659 41515 23257 12.5% 5.3 6200 12453 12.6%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.33 20.33 0.00 0.00 1.2754 0.0000 509756.08 509756.08 0.00 19655.90 19655.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.66 12.56% 12452.99 11528 16389 5970.65 0 16389 8246 8246 0.00
multistrike 4.61 87.44% 6200.14 5764 8195 6109.63 0 8195 28575 28575 0.00
hit 17.80 87.54% 20658.87 19213 27316 20676.47 19213 25290 367746 367746 0.00
crit 2.53 12.46% 41514.85 38426 54631 38091.75 0 54631 105188 105188 0.00
 
DPS Timeline Chart
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Deals $sw1 Holy damage to all enemies within $A1 yards. {$?s63220=true}[Using Divine Storm will also heal you for {$115515s1=4}% of your maximum health.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.78
 
execution_sentence 1245 4.8% 5.5 60.78sec 68469 51814 Periodic 53.4 5690 11704 6482 13.2% 13.9 1709 3518 13.1% 17.8%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.45 5.45 53.43 53.43 1.3215 1.0000 373368.98 373368.98 0.00 6157.55 51813.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.8 13.08% 3518.33 1126 19672 2911.65 0 19672 6391 6391 0.00
multistrike 12.1 86.92% 1709.39 563 9836 1710.62 0 5936 20626 20626 0.00
hit 46.4 86.83% 5690.12 1877 32786 5698.55 3451 7205 263974 263974 0.00
crit 7.0 13.17% 11703.52 3754 65572 11698.47 0 65572 82377 82377 0.00
 
DPS Timeline Chart
 

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4096.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc114916=A hammer slowly falls from the sky, causing ${$SPH*$114916m2/1000+26.72716306*$114916m1} Holy damage over {$114916d=10 seconds}. Damage increases over time, culminating in a final burst. Dispelling the effect triggers the final burst.} |CFFFFFFFFStay of Execution|R On a friendly target, the falling hammer heals for ${$SPH*$114917m2/1000+26.72716306*$114917m1} over {$114917d=10 seconds}. This healing is a large burst at first, and then decreases over time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.342049
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
exorcism 346 1.3% 9.2 18.08sec 11372 9006 Direct 9.2 9383 18763 10554 12.5% 2.4 2815 5625 12.4%  

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.19 9.19 0.00 0.00 1.2628 0.0000 104551.99 104551.99 0.00 9006.12 9006.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.29 12.40% 5625.00 5553 6855 1419.05 0 6855 1658 1658 0.00
multistrike 2.08 87.60% 2815.14 2776 3428 2453.03 0 3428 5861 5861 0.00
hit 8.05 87.51% 9382.80 9255 11425 9385.76 0 10340 75485 75485 0.00
crit 1.15 12.49% 18763.36 18510 22851 12895.58 0 22851 21548 21548 0.00
 
DPS Timeline Chart
 

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1280.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:
  • description:Blasts the target with Holy Light, causing {$s1=1} Holy damage and generating 1 Holy Power. Your autoattacks have a {$87138h=20}% chance of resetting the cooldown of your Exorcism.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.686240
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
final_verdict 5739 22.1% 66.8 4.47sec 25808 20280 Direct 66.8 21245 42665 23943 12.6% 17.4 6372 12806 12.6%  

Stats details: final_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.80 66.80 0.00 0.00 1.2726 0.0000 1724123.42 1724123.42 0.00 20279.75 20279.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.18 12.57% 12805.91 11823 16810 11285.01 0 16810 27933 27933 0.00
multistrike 15.18 87.43% 6372.31 5912 8405 6377.08 0 7906 96706 96706 0.00
hit 58.39 87.41% 21244.89 19706 28016 21261.38 20356 22641 1240506 1240506 0.00
crit 8.41 12.59% 42665.50 39411 56032 42692.44 0 56032 358978 358978 0.00
 
DPS Timeline Chart
 

Action details: final_verdict

Static Values
  • id:157048
  • school:holy
  • resource:holy_power
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5|buff.holy_avenger.up&holy_power>=3
Spelldata
  • id:157048
  • name:Final Verdict
  • school:holy
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
hammer_of_wrath 2007 7.7% 30.4 10.10sec 19720 15509 Direct 30.4 16188 32741 18303 12.8% 7.9 4852 9825 12.7%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.42 30.41 0.00 0.00 1.2715 0.0000 599937.81 599937.81 0.00 15509.08 15509.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.01 12.73% 9825.09 8348 12367 6225.34 0 12367 9879 9879 0.00
multistrike 6.89 87.27% 4852.07 4174 6183 4852.12 0 6183 33438 33438 0.00
hit 26.53 87.22% 16188.25 13913 20611 16200.23 14979 17484 429396 429396 0.00
crit 3.89 12.78% 32740.73 27826 41223 32192.63 0 41223 127224 127224 0.00
 
DPS Timeline Chart
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.028000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
hand_of_light 6734 26.0% 226.1 1.67sec 8941 0 Direct 226.1 8941 0 8941 0.0% 0.0 0 0 0.0%  

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 226.13 226.13 0.00 0.00 0.0000 0.0000 2021919.78 2021919.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 226.13 100.00% 8941.41 1162 33850 8952.97 7657 10318 2021920 2021920 0.00
 
DPS Timeline Chart
 

Action details: hand_of_light

Static Values
  • id:96172
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7693.27
  • base_dd_max:7693.27
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
judgment 1505 5.8% 39.4 7.61sec 11490 9083 Direct 39.4 9446 19020 10660 12.7% 10.2 2835 5712 12.7%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.36 39.36 0.00 0.00 1.2650 0.0000 452296.67 452296.67 0.00 9083.17 9083.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.30 12.74% 5712.10 5236 7757 4135.85 0 7757 7428 7428 0.00
multistrike 8.90 87.26% 2834.98 2618 3879 2836.78 0 3879 25240 25240 0.00
hit 34.37 87.32% 9446.08 8727 12928 9454.03 8727 10233 324682 324682 0.00
crit 4.99 12.68% 19020.38 17454 25857 18936.06 0 25857 94947 94947 0.00
 
DPS Timeline Chart
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.empowered_seals.enabled&time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Causes {$s1=1} Holy damage {$?s105424=false}[and generates 1 Holy Power]?s85256[and generates 1 Holy Power][]. Requires an active Seal to cast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.696000
  • spell_power_mod.direct:0.576000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 2458 9.5% 98.6 3.04sec 7492 2463 Direct 98.6 6158 12386 6951 12.7% 25.6 1847 3716 12.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.59 98.59 0.00 0.00 3.0417 0.0000 738704.36 1135271.97 34.93 2463.24 2463.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.27 12.78% 3715.99 3435 4897 3570.76 0 4897 12144 18663 33.54
multistrike 22.30 87.22% 1847.09 1718 2449 1848.56 1718 2171 41191 63304 34.93
hit 86.03 87.25% 6157.57 5725 8162 6162.32 5955 6349 529711 814082 34.93
crit 12.57 12.75% 12385.99 11450 16325 12396.43 0 16325 155659 239223 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
seal_of_truth_proc 1376 5.3% 297.2 1.01sec 1391 0 Direct 297.2 1141 2296 1290 12.9% 77.0 342 689 12.9%  

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 297.17 297.17 0.00 0.00 0.0000 0.0000 413242.90 413242.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.92 12.88% 688.59 634 903 689.10 0 903 6831 6831 0.00
multistrike 67.08 87.12% 342.37 317 452 342.65 317 379 22968 22968 0.00
hit 258.79 87.08% 1141.14 1056 1505 1142.05 1112 1170 295318 295318 0.00
crit 38.38 12.92% 2296.13 2112 3011 2298.07 2112 2602 88127 88127 0.00
 
DPS Timeline Chart
 

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.12
 
shattered_bleed 393 1.5% 17.5 17.48sec 6752 0 Direct 17.5 1651 3307 1864 12.9% 4.5 495 992 13.0%  
Periodic 97.7 787 0 787 0.0% 25.3 239 0 0.0% 32.5%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.49 17.49 97.73 97.73 0.0000 1.0000 118106.94 118106.94 0.00 1208.49 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.59 12.98% 991.80 956 1147 437.45 0 1147 584 584 0.00
multistrike 3.95 87.02% 495.22 478 573 484.48 0 573 1954 1954 0.00
hit 15.24 87.12% 1650.59 1593 1911 1650.44 1593 1813 25153 25153 0.00
crit 2.25 12.88% 3307.12 3186 3823 2966.15 0 3823 7453 7453 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 25.3 100.00% 238.93 239 239 238.93 239 239 6056 6056 0.00
hit 97.7 100.00% 786.92 1 796 787.21 758 796 76907 76907 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Zambo
avenging_wrath 3.0 121.50sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 2.96 2.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.48 83.71% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.48 16.29% 0.00 0 0 0.00 0 0 0 0 0.00
 
HPS Timeline Chart
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:119.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:talent.seraphim.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
 
draenic_strength_potion 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156428
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
 
glyph_of_divine_storm 20.3 13.94sec

Stats details: glyph_of_divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 20.33 20.33 0.00 0.00 0.0000 0.0000 0.00 276591.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.84 15.85% 0.00 0 0 0.00 0 0 0 5470 55.73
multistrike 4.44 84.15% 0.00 0 0 0.00 0 0 0 14523 98.24
hit 17.10 84.13% 0.00 0 0 0.00 0 0 0 186312 100.00
crit 3.23 15.87% 0.00 0 0 0.00 0 0 0 70287 95.82
 
HPS Timeline Chart
 

Action details: glyph_of_divine_storm

Static Values
  • id:63220
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:
Spelldata
  • id:63220
  • name:Glyph of Divine Storm
  • school:physical
  • tooltip:
  • description:Your Divine Storm also heals you for {$115515s1=4}% of your maximum health.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
avenging_wrath 3.0 0.0 121.5sec 121.5sec 19.06% 40.98% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avenging_wrath_1:19.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_crusader 20.5 1.3 13.9sec 13.0sec 17.77% 100.00% 1.3(1.3)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_crusader
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_crusader_1:17.77%

Trigger Attempt Success

  • trigger_pct:24.81%

Spelldata details

  • id:144595
  • name:Divine Crusader
  • tooltip:Your next Divine Storm is free and deals {$s2=50}% more damage.
  • description:{$@spelldesc144593=Holy Power consumers have a 25% chance to make your next Divine Storm free and deal {$144595s2=50}% more damage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
divine_purpose 20.5 1.3 13.9sec 13.0sec 15.38% 100.00% 1.3(1.3)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_purpose_1:15.38%

Trigger Attempt Success

  • trigger_pct:24.74%

Spelldata details

  • id:86172
  • name:Divine Purpose
  • tooltip:
  • description:{$?s114163=false}[Eternal Flame][Word of Glory]{$?s53600=false}[ and Shield of the Righteous have]?s53563[ and Light of Dawn have]?s85256[, Templar's Verdict, and Divine Storm have][ has] a {$s1=25}% chance to cause your next {$?s114163=false}[Eternal Flame][Word of Glory] or {$?s53600=false}[Shield of the Righteous]?s53563[Light of Dawn]?s157048[Final Verdict or Divine Storm][Templar's Verdict or Divine Storm] to consume no Holy Power but cast as if 3 were consumed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
draenic_strength_potion 2.0 0.0 122.8sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
final_verdict 21.1 63.1 14.0sec 3.5sec 76.91% 76.92% 63.1(63.1)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • final_verdict_1:76.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157048
  • name:Final Verdict
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
selfless_healer 3.4 46.2 97.7sec 6.0sec 94.50% 94.50% 40.2(40.2)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_selfless_healer
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • selfless_healer_1:6.02%
  • selfless_healer_2:5.85%
  • selfless_healer_3:82.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114250
  • name:Selfless Healer
  • tooltip:Your next Flash of Light casts $w1% faster, costs $w3% less mana, and heals for $w2% greater effectiveness on others.
  • description:{$@spelldesc85804=Your successful Judgments reduce the cast time and mana cost of your next Flash of Light by {$114250s1=35}%, and increase its effect on others by $?c1[{$114250s4=35}][{$114250s2=20}]%. Stacks up to 3 times.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
tectus_heartbeat 5.7 0.0 51.0sec 50.5sec 18.62% 18.64% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_tectus_heartbeat
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1743.00

Stack Uptimes

  • tectus_heartbeat_1:18.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177040
  • name:Tectus' Heartbeat
  • tooltip:Increases Critical Strike by {$s1=1135}.
  • description:Increases Critical Strike by {$s1=1135} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
seal_of_truth

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_seal_of_truth
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • seal_of_truth_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31801
  • name:Seal of Truth
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zambo
crusader_strike Mana 62.0 39672.1 640.0 640.0 12.9
execution_sentence Mana 5.5 22335.5 4096.0 4095.9 16.7
exorcism Mana 9.2 11767.9 1280.0 1280.0 8.9
final_verdict Holy Power 66.8 139.4 2.1 2.1 12368.6
hammer_of_wrath Mana 30.4 29205.7 960.0 960.0 20.5
Resource Gains Type Count Total Average Overflow
glyph_of_divine_storm Health 25.61 0.00 (0.00%) 0.00 276584.73 100.00%
external_healing Health 8.51 0.00 (0.00%) 0.00 79159.37 100.00%
leech Health 1349.31 0.00 (0.00%) 0.00 33986.49 100.00%
sword_of_light Mana 149.67 102184.92 (100.00%) 682.73 185183.43 64.44%
crusader_strike Holy Power 61.99 61.99 (43.98%) 1.00 0.00 0.00%
exorcism Holy Power 9.19 9.19 (6.52%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 30.41 30.41 (21.57%) 1.00 0.00 0.00%
judgment Holy Power 39.36 39.36 (27.93%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 339.54 342.18
Holy Power 0.47 0.46
Combat End Resource Mean Min Max
Mana 31206.32 26944.00 32000.00
Holy Power 1.58 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 40.9%

Procs

Count Interval
divine_purpose 21.8 13.0sec
divine_crusader 21.8 13.0sec
exorcism_cd_reset 19.8 14.6sec
wasted_exorcism_cd_reset 14.2 20.5sec

Statistics & Data Analysis

Fight Length
Sample Data Zambo Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Zambo Damage Per Second
Count 25000
Mean 25933.79
Minimum 23008.21
Maximum 30231.60
Spread ( max - min ) 7223.38
Range [ ( max - min ) / 2 * 100% ] 13.93%
Standard Deviation 914.2438
5th Percentile 24492.84
95th Percentile 27503.28
( 95th Percentile - 5th Percentile ) 3010.44
Mean Distribution
Standard Deviation 5.7822
95.00% Confidence Intervall ( 25922.46 - 25945.13 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4774
0.1 Scale Factor Error with Delta=300 7135
0.05 Scale Factor Error with Delta=300 28540
0.01 Scale Factor Error with Delta=300 713522
Distribution Chart
DPS(e)
Sample Data Zambo Damage Per Second (Effective)
Count 25000
Mean 25933.79
Minimum 23008.21
Maximum 30231.60
Spread ( max - min ) 7223.38
Range [ ( max - min ) / 2 * 100% ] 13.93%
Damage
Sample Data Zambo Damage
Count 25000
Mean 7788635.98
Minimum 5699453.62
Maximum 10097398.61
Spread ( max - min ) 4397944.99
Range [ ( max - min ) / 2 * 100% ] 28.23%
DTPS
Sample Data Zambo Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zambo Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Zambo Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zambo Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zambo Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zambo Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ZamboTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Zambo Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=sleeper_surprise
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up
4 0.00 seal_of_truth,if=active_enemies<2
5 0.00 seal_of_righteousness,if=active_enemies>=2
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_strength
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 rebuke
9 1.00 potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
A 1.00 auto_attack
B 0.00 speed_of_light,if=movement.distance>5
C 0.00 judgment,if=talent.empowered_seals.enabled&time<2
D 5.45 execution_sentence
E 0.00 lights_hammer
F 0.00 holy_avenger,sync=seraphim,if=talent.seraphim.enabled
G 0.00 holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
H 0.00 avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
I 2.96 avenging_wrath,if=!talent.seraphim.enabled
J 0.00 blood_fury
K 0.00 berserking
L 0.00 arcane_torrent
M 0.00 seraphim
N 0.00 wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
O 0.00 call_action_list,name=aoe,if=active_enemies>=5
P 0.00 call_action_list,name=cleave,if=active_enemies>=3
Q 0.00 call_action_list,name=single
actions.single
# count action,conditions
R 0.10 divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
S 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
T 0.00 divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
U 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
V 0.00 templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
W 0.00 templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
X 0.00 divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
Y 2.26 final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
Z 0.25 final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
a 30.42 hammer_of_wrath
b 0.00 judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
c 0.00 judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
d 0.00 exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
e 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
f 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
g 10.57 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
h 34.52 final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
i 0.00 templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
j 61.99 crusader_strike,if=holy_power<5
k 0.00 divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
l 9.67 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
m 9.51 final_verdict,if=buff.divine_purpose.react
n 10.52 final_verdict,if=holy_power>=4
o 0.00 judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
p 0.00 exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
q 39.36 judgment,,if=holy_power<5
r 9.75 final_verdict,if=holy_power>=3
s 0.00 exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
t 0.00 templars_verdict,if=buff.divine_purpose.react
u 0.00 divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
v 0.00 templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
w 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
x 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
y 9.19 exorcism,if=holy_power<5
z 0.00 templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
{ 0.00 holy_prism

Sample Sequence

0147ADIajqhagjqahghagjhajqhjyqjnmjqrjyqjnyjqnjmqjnljmqjnmjqrDjlqjryjqrjqjrljqyjnqjrmjqyjnqjrljqyjnljqrjqDI9ahghajqhajqhahjqrjlqjryjqrjqjryjqrjqjryjqrDjqjrqajhqajhqajhqajhqajhgajqhajqhaghjahjqahjDIajhqajhqajhhajqhahjqahjqahjqahjqahjqahhjahhj

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre seal_of_truth Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:00.000 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:01.322 avenging_wrath Zambo 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, draenic_strength_potion
0:01.322 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:02.341 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:03.359 judgment Fluffy_Pillow 28224.0/32000: 88% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:04.376 final_verdict Fluffy_Pillow 30144.0/32000: 94% mana | 3.0/5: 60% holy_power bloodlust, selfless_healer, avenging_wrath, draenic_strength_potion
0:05.395 hammer_of_wrath Fluffy_Pillow 30144.0/32000: 94% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, selfless_healer, avenging_wrath, divine_crusader, draenic_strength_potion
0:06.411 divine_storm Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer, avenging_wrath, divine_crusader, draenic_strength_potion
0:07.429 crusader_strike Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power bloodlust, selfless_healer, avenging_wrath, divine_crusader, draenic_strength_potion
0:08.447 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, selfless_healer, avenging_wrath, divine_crusader, draenic_strength_potion
0:09.463 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, selfless_healer(2), avenging_wrath, divine_crusader, draenic_strength_potion
0:10.480 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, selfless_healer(2), avenging_wrath, divine_crusader, draenic_strength_potion
0:11.497 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, divine_crusader, draenic_strength_potion
0:12.514 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:13.531 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, divine_crusader, draenic_strength_potion
0:14.548 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, divine_crusader, draenic_strength_potion
0:15.566 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:16.584 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:17.602 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:18.619 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:19.637 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:20.652 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3), avenging_wrath
0:21.669 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, selfless_healer(3)
0:22.686 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3)
0:23.704 judgment Fluffy_Pillow 30720.0/32000: 96% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(3)
0:24.721 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3)
0:25.737 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, final_verdict, selfless_healer(3)
0:26.754 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, final_verdict, selfless_healer(3)
0:27.772 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3)
0:28.787 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(3)
0:29.804 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3)
0:30.821 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, selfless_healer(3)
0:31.837 Waiting 1.000 sec 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3)
0:32.837 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3)
0:33.854 judgment Fluffy_Pillow 30720.0/32000: 96% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(3), tectus_heartbeat
0:34.874 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3), tectus_heartbeat
0:35.891 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, final_verdict, selfless_healer(3), tectus_heartbeat
0:36.907 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, selfless_healer(3), tectus_heartbeat
0:37.925 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, selfless_healer(3), tectus_heartbeat
0:38.941 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, selfless_healer(3), tectus_heartbeat
0:39.959 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, final_verdict, selfless_healer(3), tectus_heartbeat
0:40.976 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
0:41.995 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
0:43.317 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
0:44.639 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
0:45.960 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
0:47.281 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
0:48.603 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, selfless_healer(3)
0:49.925 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_purpose, selfless_healer(3)
0:51.246 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
0:52.567 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
0:53.888 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
0:55.210 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3)
0:56.531 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
0:57.852 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
0:59.174 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:00.499 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
1:01.819 crusader_strike Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
1:03.141 divine_storm Fluffy_Pillow 29184.0/32000: 91% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
1:04.461 judgment Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power selfless_healer(3)
1:05.782 crusader_strike Fluffy_Pillow 31104.0/32000: 97% mana | 2.0/5: 40% holy_power selfless_healer(3), tectus_heartbeat
1:07.104 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), tectus_heartbeat
1:08.425 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:09.746 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:11.067 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:12.390 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:13.712 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:15.032 Waiting 1.400 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:16.432 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:17.753 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:19.074 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:20.395 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
1:21.718 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3)
1:23.040 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
1:24.363 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
1:25.684 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power selfless_healer(3)
1:27.006 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power selfless_healer(3)
1:28.329 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:29.652 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:30.974 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:32.294 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3)
1:33.615 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
1:34.939 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:36.260 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:37.581 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:38.903 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
1:40.224 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
1:41.546 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
1:42.866 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:44.185 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
1:45.508 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3), divine_crusader
1:46.830 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3), divine_crusader
1:48.152 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3), divine_crusader
1:49.472 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power selfless_healer(3), divine_crusader
1:50.793 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power selfless_healer(3), divine_crusader
1:52.114 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader
1:53.436 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
1:54.757 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
1:56.079 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
1:57.400 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
1:58.722 Waiting 1.400 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
2:00.122 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
2:01.444 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
2:02.766 avenging_wrath Zambo 29824.0/32000: 93% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
2:02.766 potion Fluffy_Pillow 29824.0/32000: 93% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
2:02.766 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat, draenic_strength_potion
2:04.087 final_verdict Fluffy_Pillow 30784.0/32000: 96% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat, draenic_strength_potion
2:05.408 divine_storm Fluffy_Pillow 30784.0/32000: 96% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, tectus_heartbeat, draenic_strength_potion
2:06.731 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, selfless_healer(3), avenging_wrath, tectus_heartbeat, draenic_strength_potion
2:08.052 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:09.373 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:10.692 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:12.014 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:13.338 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:14.658 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:15.979 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:17.301 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:18.622 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:19.944 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:21.265 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:22.586 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:23.908 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), draenic_strength_potion
2:25.230 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader, draenic_strength_potion
2:26.550 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), divine_crusader, draenic_strength_potion
2:27.874 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
2:29.196 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
2:30.517 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
2:31.838 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
2:33.160 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:34.481 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
2:35.804 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
2:37.124 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
2:38.447 Waiting 1.400 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:39.847 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:41.168 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
2:42.489 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
2:43.811 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
2:45.133 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:46.454 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
2:47.776 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
2:49.096 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
2:50.420 Waiting 1.400 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:51.820 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:53.141 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
2:54.463 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
2:55.784 Waiting 1.200 sec 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
2:56.984 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
2:58.306 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
2:59.629 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:00.951 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:02.272 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:03.595 crusader_strike Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:04.917 judgment Fluffy_Pillow 29184.0/32000: 91% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:06.238 Waiting 1.400 sec 31104.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:07.638 crusader_strike Fluffy_Pillow 31104.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:08.959 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:10.280 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:11.601 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:12.922 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:14.243 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:15.563 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:16.886 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:18.209 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:19.532 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:20.855 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:22.175 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:23.496 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:24.816 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:26.138 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:27.459 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:28.781 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:30.101 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:31.423 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:32.744 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:34.065 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:35.386 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:36.708 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader
3:38.030 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3)
3:39.352 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power selfless_healer(3)
3:40.675 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3)
3:41.997 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
3:43.319 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:44.640 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:45.964 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:47.285 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:48.607 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), divine_crusader
3:49.929 divine_storm Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3), divine_crusader
3:51.251 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, selfless_healer(3)
3:52.570 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:53.891 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
3:55.214 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
3:56.534 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)
3:57.855 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:59.174 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:00.496 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:01.817 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
4:03.140 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
4:04.462 avenging_wrath Zambo 29824.0/32000: 93% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
4:04.462 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:05.783 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:07.105 final_verdict Fluffy_Pillow 30144.0/32000: 94% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:08.425 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:09.745 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:11.067 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:12.391 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:13.714 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:15.035 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:16.357 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:17.679 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:19.000 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:20.322 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:21.645 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:22.968 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:24.290 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
4:25.612 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
4:26.934 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
4:28.254 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:29.578 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:30.900 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:32.221 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
4:33.543 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:34.864 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:36.185 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:37.507 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
4:38.829 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:40.150 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:41.473 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:42.795 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
4:44.116 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:45.437 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:46.758 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:48.080 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
4:49.401 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:50.722 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:52.044 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:53.366 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
4:54.689 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict, selfless_healer(3)
4:56.011 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
4:57.333 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3)
4:58.655 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
4:59.977 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, final_verdict, selfless_healer(3)
5:01.299 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4698 4211 4084 (1424)
Agility 477 455 455
Stamina 4539 4127 4127
Intellect 1094 1042 1042
Spirit 782 782 782
Health 272340 247620 0
Mana 32000 32000 0
Holy Power 5 5 0
Spell Power 5168 4211 0
Crit 12.75% 7.75% 302
Haste 13.89% 8.47% 847
Multistrike 12.97% 7.97% 526
Damage / Heal Versatility 6.19% 3.19% 415
Attack Power 5168 4211 0
Mastery 60.41% 46.44% 1390
Armor 2013 2013 2013

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Blinding Light
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence
100 Empowered Seals Seraphim Final Verdict (Retribution Paladin)

Profile

paladin="Zambo"
origin="http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced"
thumbnail="http://eu.battle.net/static-render/eu/nazjatar/126/78079358-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=blacksmithing=692/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!2001222
glyphs=divine_storm/templars_verdict/divine_protection/bladed_judgment/fire_from_the_heavens/winged_vengeance
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up
actions.precombat+=/seal_of_truth,if=active_enemies<2
actions.precombat+=/seal_of_righteousness,if=active_enemies>=2
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_strength

# Executed every time the actor is available.

actions=rebuke
actions+=/potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
actions+=/auto_attack
actions+=/speed_of_light,if=movement.distance>5
actions+=/judgment,if=talent.empowered_seals.enabled&time<2
actions+=/execution_sentence
actions+=/lights_hammer
actions+=/holy_avenger,sync=seraphim,if=talent.seraphim.enabled
actions+=/holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
actions+=/avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
actions+=/avenging_wrath,if=!talent.seraphim.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/seraphim
actions+=/wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
actions+=/call_action_list,name=aoe,if=active_enemies>=5
actions+=/call_action_list,name=cleave,if=active_enemies>=3
actions+=/call_action_list,name=single

actions.single=divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
actions.single+=/templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.single+=/templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
actions.single+=/final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
actions.single+=/final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
actions.single+=/hammer_of_wrath
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
actions.single+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
actions.single+=/final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
actions.single+=/templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.single+=/crusader_strike,if=holy_power<5
actions.single+=/divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
actions.single+=/final_verdict,if=buff.divine_purpose.react
actions.single+=/final_verdict,if=holy_power>=4
actions.single+=/judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
actions.single+=/exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
actions.single+=/judgment,,if=holy_power<5
actions.single+=/final_verdict,if=holy_power>=3
actions.single+=/exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
actions.single+=/templars_verdict,if=buff.divine_purpose.react
actions.single+=/divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
actions.single+=/templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
actions.single+=/exorcism,if=holy_power<5
actions.single+=/templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
actions.single+=/holy_prism

actions.cleave=final_verdict,if=buff.final_verdict.down&holy_power=5
actions.cleave+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)&!talent.final_verdict.enabled
actions.cleave+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.cleave+=/hammer_of_wrath
actions.cleave+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.cleave+=/divine_storm,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)&!talent.final_verdict.enabled
actions.cleave+=/crusader_strike
actions.cleave+=/divine_storm,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)&!talent.final_verdict.enabled
actions.cleave+=/final_verdict,if=buff.final_verdict.down
actions.cleave+=/divine_storm,if=buff.final_verdict.up
actions.cleave+=/exorcism,if=glyph.mass_exorcism.enabled
actions.cleave+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.cleave+=/judgment
actions.cleave+=/exorcism

actions.aoe=divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)
actions.aoe+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.aoe+=/hammer_of_wrath
actions.aoe+=/hammer_of_the_righteous
actions.aoe+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.aoe+=/divine_storm,if=(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.aoe+=/exorcism,if=glyph.mass_exorcism.enabled
actions.aoe+=/holy_prism,target=self
actions.aoe+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.aoe+=/judgment
actions.aoe+=/exorcism

head=casque_of_the_iron_bomber,id=113600,bonus_id=566
neck=koraghs_family_locket,id=113841,bonus_id=560,enchant=75mastery
shoulders=primal_gladiators_plate_shoulders,id=115740
back=cloak_of_ruminant_deception,id=113830,bonus_id=566,enchant=gift_of_mastery
chest=truesteel_breastplate,id=114232,bonus_id=181/526/534
wrists=crazed_bombers_bracers,id=114496,bonus_id=488
hands=gauntlets_of_the_heavy_hand,id=113632
waist=bouldercrush_girdle,id=118948,bonus_id=141/560
legs=legplates_of_fractured_crystal,id=113648,bonus_id=41
feet=entrail_squishers,id=113633,bonus_id=564/566,gems=50mastery
finger1=timeless_solium_band_of_brutality,id=118295,enchant=30mastery
finger2=grunts_solid_signet,id=113599,enchant=50mastery
trinket1=grandiose_carnage,id=114552
trinket2=tectus_beating_heart,id=113645
main_hand=grandiose_greataxe,id=115328,bonus_id=115/560,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_strength=2557
# gear_stamina=3237
# gear_crit_rating=302
# gear_haste_rating=847
# gear_mastery_rating=1324
# gear_armor=2013
# gear_multistrike_rating=526
# gear_versatility_rating=315
# gear_leech_rating=120

Swæty

Swæty : 21423 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
21423.4 21423.4 6.7 / 0.031% 2133.4 / 10.0% 53.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
391.0 391.0 Mana 0.00% 40.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced
Talents
  • 15: Angelic Bulwark
  • 30: Body and Soul
  • 45: Insanity (Shadow Priest)
  • 60: Dominate Mind
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Halo (Shadow Priest)
  • 100: Clarity of Power (Shadow Priest)
  • Talent Calculator
Glyphs
  • Glyph of Fade
  • Glyph of Mind Blast
  • Glyph of Mind Flay
  • Glyph of Dark Archangel
  • Glyph of the Heavens
  • Glyph of Shadow Ravens
Professions
  • mining: 700
  • enchanting: 679

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:41164|27975|26259|23336|22736|21682|15232|13627&chds=0,82327&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++41164++devouring_plague,9482C9,0,0,15|t++27975++shadow_word_pain,9482C9,1,0,15|t++26259++shadow_word_death,9482C9,2,0,15|t++23336++halo,9482C9,3,0,15|t++22736++mind_blast,9482C9,4,0,15|t++21682++vampiric_touch,9482C9,5,0,15|t++15232++mind_spike,4A79D3,6,0,15|t++13627++insanity,9482C9,7,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:27,20,15,10,9,7,4,3,3,2,2,1&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9&chl=mind_blast|mind_spike|insanity|devouring_plague|devouring_plague_tick|shadow_word_death|shadow_word_pain|vampiric_touch|halo_damage|shadowfiend: melee|shattered_bleed|shadowy_apparitions&
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:knrwxz17782535525530241y01zwy120yzyvsqrqomooonpoonoqqonpqrqppppomllllkjhijjjkkllnmmnoppppqrrqppponnmmmljjjijkkklmmmnnnooooppqpppoonmmmllkkjkkkllmmmmnnnooooopppooonnmmlllkkkjkklllmnnnopppqqqrssssssssrrqqqqqqqqqqrrrrrrrsssstttttttsssssrrrrrrrrsssssttttttuuuuuvvvvvvuuuvvvvvvvvvwwwwwwxxxxxxxxyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzyyyyxxxwwwvvvuuttssrrqqpponljhfcaYWUSQ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.735276,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=21423|max=29137&chxp=1,1,74,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,3,6,19,31,35,75,138,147,247,355,433,587,758,951,1085,1229,1433,1465,1578,1601,1508,1469,1338,1315,1239,1024,918,806,655,585,450,376,259,211,187,139,108,59,66,39,24,13,13,5,7,4,2,1,1&chds=0,1601&chbh=5&chxt=x&chxl=0:|min=19620|avg=21423|max=23800&chxp=0,1,43,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:28.0,24.7,22.4,9.6,5.2,3.3,3.2,2.9,0.8&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_spike 84.3s|mind_blast 74.3s|insanity 67.4s|devouring_plague 29.0s|shadow_word_death 15.6s|shadow_word_pain 9.9s|vampiric_touch 9.7s|halo 8.7s|shadowfiend 2.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Swæty 21423
devouring_plague 1999 (3963) 9.3% (18.5%) 22.0 13.14sec 54283 41164 Direct 22.0 21604 43203 25640 18.7% 5.0 6482 12967 18.6%  

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.97 21.97 0.00 0.00 1.3187 0.0000 601391.67 601391.67 0.00 41163.64 41163.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.92 18.55% 12967.17 12566 15435 7796.11 0 15435 11940 11940 0.00
multistrike 4.04 81.45% 6481.69 6283 7717 6370.25 0 7717 26201 26201 0.00
hit 17.86 81.32% 21604.27 20943 25725 21617.48 20943 22682 385917 385917 0.00
crit 4.10 18.68% 43203.43 41887 51449 42660.54 0 51449 177334 177334 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=5&talent.surge_of_darkness.enabled
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=2869} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    devouring_plague_tick 1964 9.2% 26.9 10.63sec 21948 0 Periodic 161.0 3672 0 3672 0.0% 0.0 0 0 0.0% 39.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.93 0.00 134.03 160.96 0.0000 0.8758 591077.71 0.00 0.00 5035.59 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.0 100.00% 3672.09 0 11760 3674.37 3044 4878 591078 0 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=2869} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
halo 0 (678) 0.0% (3.2%) 6.7 48.04sec 30388 23336

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 1.3022 0.0000 0.00 0.00 0.00 23336.11 23336.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.46 81.56% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.24 18.44% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled&target.distance<=30&active_enemies>2
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3120} Shadow damage to enemies, with the greatest effect at 25 yds.
 
    halo_damage 678 3.2% 6.7 48.04sec 30388 0 Direct 6.7 23983 47966 28454 18.6% 1.5 7199 14402 18.9%  

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 0.0000 0.0000 203607.54 203607.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.29 18.94% 14401.67 13670 16791 3615.38 0 16791 4126 4126 0.00
multistrike 1.23 81.06% 7199.33 6835 8396 5178.57 0 8396 8830 8830 0.00
hit 5.45 81.36% 23982.92 22783 27986 24015.14 0 27986 130738 130738 0.00
crit 1.25 18.64% 47966.32 45566 55971 35647.63 0 55971 59914 59914 0.00
 
DPS Timeline Chart
 

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3120} Shadow damage to enemies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.264000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
insanity 3053 14.3% 35.4 7.86sec 25961 13627 Periodic 95.2 7611 15221 9035 18.7% 21.6 2283 4567 18.7% 20.7%

Stats details: insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.39 35.39 95.21 95.21 1.9051 0.6534 918694.70 918694.70 0.00 13627.05 13627.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.0 18.69% 4566.90 4491 5517 4480.71 0 5517 18437 18437 0.00
multistrike 17.6 81.31% 2283.30 2246 2759 2284.20 2246 2553 40105 40105 0.00
hit 77.4 81.30% 7611.29 7486 9195 7614.36 7486 7841 589124 589124 0.00
crit 17.8 18.70% 15220.96 14972 18390 15226.95 14972 17023 271028 271028 0.00
 
DPS Timeline Chart
 

Action details: insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2
Spelldata
  • id:129197
  • name:Insanity
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
mind_blast 5622 26.2% 57.2 5.30sec 29547 22736 Direct 57.2 23313 46614 27668 18.7% 12.9 6994 13993 18.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.18 57.18 0.00 0.00 1.2996 0.0000 1689468.72 1689468.72 0.00 22736.03 22736.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.43 18.82% 13992.78 13476 16553 12740.98 0 16553 34055 34055 0.00
multistrike 10.50 81.18% 6993.65 6738 8276 6997.34 0 8276 73412 73412 0.00
hit 46.49 81.31% 23312.97 22460 27588 23326.68 22716 24062 1083895 1083895 0.00
crit 10.69 18.69% 46613.90 44920 55176 46646.35 44920 55176 498108 498108 0.00
 
DPS Timeline Chart
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:6.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=1722} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.{$?s162532=false}[ The first time you hit an enemy with Mind Blast, you gain {$162532s1=2} additional $LOrb:Orbs;.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mind_spike 4275 19.9% 67.5 4.37sec 19023 15232 Direct 67.5 15002 30004 17812 18.7% 15.3 4499 9003 18.6%  

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.48 67.48 0.00 0.00 1.2489 0.0000 1283749.93 1283749.93 0.00 15232.33 15232.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.85 18.64% 9002.82 6177 10622 8466.49 0 10622 25693 25693 0.00
multistrike 12.46 81.36% 4499.00 3089 5311 4501.17 3706 5311 56060 56060 0.00
hit 54.84 81.27% 15001.52 10295 17704 15009.66 14431 15647 822737 822737 0.00
crit 12.64 18.73% 30003.70 20591 35408 30020.79 0 35408 379261 379261 0.00
 
DPS Timeline Chart
 

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:191.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=790} Shadowfrost damage, but extinguishes your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.825000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_death 1366 6.4% 11.6 5.36sec 35410 26259 Direct 11.6 27987 55961 33158 18.5% 2.6 8391 16815 18.5%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.60 11.60 0.00 0.00 1.3485 0.0000 410875.37 410880.27 0.00 26259.05 26259.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.49 18.50% 16814.54 11308 19446 6508.34 0 19446 8167 8167 0.00
multistrike 2.14 81.50% 8390.88 5654 9723 7460.86 0 9723 17959 17960 0.00
hit 9.46 81.51% 27986.62 18846 32410 28015.79 20731 32410 264708 264711 0.00
crit 2.15 18.49% 55961.10 37693 64820 50607.18 0 64820 120042 120043 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:800.0
  • cooldown:8.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<20&shadow_orb<=4
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=1548} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}&!s157218[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_pain 798 (924) 3.7% (4.3%) 7.6 30.50sec 36380 27975 Direct 7.6 3414 6831 4051 18.6% 1.7 1025 2051 19.0%  
Periodic 50.9 3202 6401 3798 18.6% 11.5 995 1991 18.6% 44.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.64 7.64 50.91 50.91 1.3005 2.6035 239976.60 239976.60 0.00 1949.98 27974.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.33 19.05% 2050.94 1990 2444 573.82 0 2444 670 670 0.00
multistrike 1.39 80.95% 1024.89 995 1222 784.93 0 1222 1424 1424 0.00
hit 6.21 81.36% 3414.41 3317 4074 3416.55 3317 4074 21213 21213 0.00
crit 1.42 18.64% 6831.16 6633 8148 5388.41 0 8148 9726 9726 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.1 18.57% 1990.86 1990 2444 1756.27 0 2444 4258 4258 0.00
multistrike 9.4 81.43% 995.50 995 1222 995.44 0 1131 9334 9334 0.00
hit 41.4 81.37% 3201.86 267 4074 3202.38 3116 3351 132631 132631 0.00
crit 9.5 18.63% 6400.89 533 8148 6401.26 0 7138 60721 60721 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w2 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=455} Shadow damage and an additional $o2 Shadow damage over {$d=18 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.475000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.475000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    shadowy_apparitions 126 0.6% 9.5 22.24sec 3989 0 Direct 9.5 3142 6285 3734 18.8% 2.2 943 1885 18.9%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.49 9.49 0.00 0.00 0.0000 0.0000 37842.20 37842.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.41 18.93% 1885.30 1885 2315 628.03 0 2315 771 771 0.00
multistrike 1.75 81.07% 942.72 942 1157 766.50 0 1157 1651 1651 0.00
hit 7.70 81.18% 3142.26 3141 3858 3140.75 0 3619 24198 24198 0.00
crit 1.79 18.82% 6284.80 6282 7716 5230.18 0 7716 11222 11222 0.00
 
DPS Timeline Chart
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=430} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 381 1.8% 17.1 17.97sec 6698 0 Direct 17.1 1578 3156 1873 18.7% 3.9 473 947 18.7%  
Periodic 96.4 780 0 780 0.0% 21.8 237 0 0.0% 32.0%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.10 17.10 96.41 96.41 0.0000 1.0000 114554.00 114554.00 0.00 1188.23 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.73 18.68% 946.66 947 947 486.36 0 947 687 687 0.00
multistrike 3.16 81.32% 473.33 473 473 451.20 0 473 1495 1495 0.00
hit 13.90 81.29% 1577.77 1578 1578 1577.77 1578 1578 21935 21935 0.00
crit 3.20 18.71% 3155.54 3156 3156 3040.30 0 3156 10100 10100 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 21.8 100.00% 236.67 237 237 236.67 237 237 5168 5168 0.00
hit 96.4 100.00% 779.70 1 789 779.97 749 789 75169 75169 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
vampiric_touch 703 3.3% 7.5 31.24sec 28291 21682 Periodic 43.2 3847 7695 4564 18.6% 9.8 1226 2452 18.7% 37.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.47 7.47 43.19 43.19 1.3049 2.6043 211308.36 211308.36 0.00 1728.78 21681.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.8 18.69% 2451.60 2451 3010 2046.63 0 3010 4473 4473 0.00
multistrike 7.9 81.31% 1225.83 1225 1505 1225.60 0 1412 9731 9731 0.00
hit 35.1 81.38% 3846.75 1035 5017 3847.60 3625 4123 135203 135203 0.00
crit 8.0 18.62% 7695.07 2070 10034 7694.71 0 9101 61902 61902 0.00
 
DPS Timeline Chart
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:608.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<(15*0.3+cast_time)&miss_react&active_enemies<=5
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.585000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 5644 / 459
melee 5644 2.1% 20.0 10.60sec 6780 6128 Direct 20.0 5350 10704 6348 18.6% 4.5 1605 3211 18.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 1.1066 0.0000 135752.89 135752.89 0.00 6127.69 6127.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.86 18.91% 3210.85 2513 3549 1858.83 0 3549 2757 2757 0.00
multistrike 3.68 81.09% 1605.12 1256 1775 1571.98 0 1775 5910 5910 0.00
hit 16.29 81.37% 5350.37 4188 5916 5350.60 5013 5916 87167 87167 0.00
crit 3.73 18.63% 10703.51 8376 11832 10537.13 0 11832 39920 39920 0.00
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Swæty
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
shadowfiend 2.0 188.85sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.1945 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.64 81.40% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.37 18.60% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Lasts {$d=12 seconds}.
 
shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.81 80.91% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.19 19.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowform

Static Values
  • id:15473
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4160.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:15473
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
 
pet - shadowfiend
shadowcrawl 6.0 40.51sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.01 6.01 0.00 0.00 1.1946 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.89 81.35% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.12 18.65% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 37.51% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 259.4sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
glyph_of_mind_flay 1.0 94.2 0.0sec 2.9sec 92.04% 92.04% 94.2(94.2)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_glyph_of_mind_flay
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • glyph_of_mind_flay_1:92.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120585
  • name:Glyph of Mind Flay
  • tooltip:
  • description:Your Mind Flay spell no longer slows your victim's movement speed. Instead, each time Mind Flay deals damage you will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 5.9 0.0 11.4sec 11.4sec 16.44% 49.45% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:16.44%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_insanity 22.0 0.0 13.1sec 13.1sec 37.76% 31.28% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_insanity_1:37.76%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowy_insight 5.8 0.1 38.0sec 36.9sec 2.07% 10.09% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadowy_insight
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • shadowy_insight_1:2.07%
  • shadowy_insight_2:0.00%

Trigger Attempt Success

  • trigger_pct:5.02%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Your Shadow Word: Pain damage over time and Mind Spike damage has a {$s4=5}% chance to reset the cooldown on Mind Blast and make your next Mind Blast instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
(shadowfiend-) shadowfiend-shadowcrawl 6.0 0.0 40.5sec 40.5sec 83.34% 80.01% 0.0(0.0)

Buff details

  • buff initial source:Swæty_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
shadowform

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Swæty
devouring_plague Shadow Orb 22.0 65.9 3.0 3.0 18094.5
halo Mana 6.7 10720.7 1600.0 1600.0 19.0
insanity Mana 35.4 56619.9 1600.0 1600.0 16.2
mind_blast Mana 57.2 20557.8 359.5 359.5 82.2
mind_spike Mana 67.5 12889.4 191.0 191.0 99.6
shadow_word_death Mana 11.6 9282.6 800.0 800.0 44.3
shadow_word_pain Mana 7.6 3054.6 400.0 400.0 91.0
vampiric_touch Mana 7.5 4541.2 608.0 608.0 46.5
Resource Gains Type Count Total Average Overflow
Devouring Plague Health Health 160.96 0.00 (0.00%) 0.00 1192450.65 100.00%
Shadow Orbs from Mind Blast Shadow Orb 57.18 57.18 (83.13%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 11.60 11.60 (16.87%) 1.00 0.00 0.00%
mp5_regen Mana 200.58 116778.30 (100.00%) 582.21 75322.14 39.21%
Resource RPS-Gain RPS-Loss
Mana 388.03 390.98
Shadow Orb 0.23 0.22
Combat End Resource Mean Min Max
Mana 159104.02 156800.00 160000.00
Shadow Orb 2.89 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 33.9%
shadowfiend-Mana Cap 33.9%
mindbender-Mana Cap 33.9%

Procs

Count Interval
Shadowy Apparition Procced 9.5 22.2sec
Shadowy Insight Mind Blast CD Reset 5.9 36.9sec
Shadowy Insight Mind Blast CD Reset from Mind Spike 3.4 56.2sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 2.5 53.0sec
Shadowy Insight Mind Blast CD Reset lost to overflow 0.0 0.0sec
Mind Spike removed DoTs 1.6 86.7sec
Mind Spike removed Devouring Plague 0.0 0.0sec
Mind Spike removed Shadow Word: Pain 1.6 86.6sec
Mind Spike removed Vampiric Touch 1.5 83.6sec
Devouring Plague ticks lost from Mind Spike removal 0.0 0.0sec
Shadow Word: Pain ticks lost from Mind Spike removal 3.6 86.6sec
Vampiric Touch ticks lost from Mind Spike removal 2.8 83.6sec

Statistics & Data Analysis

Fight Length
Sample Data Swæty Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Swæty Damage Per Second
Count 25000
Mean 21423.40
Minimum 19619.97
Maximum 23799.51
Spread ( max - min ) 4179.54
Range [ ( max - min ) / 2 * 100% ] 9.75%
Standard Deviation 540.3894
5th Percentile 20579.45
95th Percentile 22352.71
( 95th Percentile - 5th Percentile ) 1773.26
Mean Distribution
Standard Deviation 3.4177
95.00% Confidence Intervall ( 21416.70 - 21430.10 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2444
0.1 Scale Factor Error with Delta=300 2492
0.05 Scale Factor Error with Delta=300 9971
0.01 Scale Factor Error with Delta=300 249285
Distribution Chart
DPS(e)
Sample Data Swæty Damage Per Second (Effective)
Count 25000
Mean 21423.40
Minimum 19619.97
Maximum 23799.51
Spread ( max - min ) 4179.54
Range [ ( max - min ) / 2 * 100% ] 9.75%
Damage
Sample Data Swæty Damage
Count 25000
Mean 6302546.80
Minimum 4699642.45
Maximum 8072613.86
Spread ( max - min ) 3372971.42
Range [ ( max - min ) / 2 * 100% ] 26.76%
DTPS
Sample Data Swæty Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Swæty Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Swæty Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Swæty Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Swæty Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Swæty Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data SwætyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Swæty Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Devouring Plague ticks lost from Mind Spike removal
Sample Data Devouring Plague ticks lost from Mind Spike removal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 1.00
Spread ( max - min ) 1.00
Range [ ( max - min ) / 2 * 100% ] 1250000.00%
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 shadowform,if=!buff.shadowform.up
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 mind_spike
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform,if=!buff.shadowform.up
8 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 power_infusion,if=talent.power_infusion.enabled
A 0.00 blood_fury
B 0.00 berserking
C 0.00 arcane_torrent
D 0.00 call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
E 0.00 call_action_list,name=decision
actions.cop_dotweave
# count action,conditions
. 7.46 devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
. 0.00 devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
. 6.91 devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
. 46.03 mind_blast,if=shadow_orb<=4&cooldown_react
. 1.94 shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
. 7.51 shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
. 7.47 vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
. 14.54 insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
. 0.13 shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
. 0.00 vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
. 5.49 halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
. 16.36 mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
. 0.09 mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
. 0.00 mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 45.19 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,moving=1
actions.cop_mfi
# count action,conditions
. 4.79 devouring_plague,if=shadow_orb=5
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
. 11.15 mind_blast,if=active_enemies<=5&cooldown_react
. 11.60 shadow_word_death,if=target.health.pct<20,cycle_targets=1
. 2.80 devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
. 0.00 mindbender,if=talent.mindbender.enabled
. 0.07 shadowfiend,if=!talent.mindbender.enabled
. 0.00 shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 1.38 insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 4.48 insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 1.21 halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 4.97 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

Sample Sequence

01356.............................................................................................................................................................................8............................

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre shadowform Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_spike Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_blast Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:01.349 shadowfiend Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:02.388 halo Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:03.426 mind_spike Fluffy_Pillow 159064.3/160000: 99% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:04.465 mind_spike Fluffy_Pillow 159538.3/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:05.503 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:06.541 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:07.579 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:08.617 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:09.657 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:10.696 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:11.734 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:12.775 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:13.812 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:14.850 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:15.890 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:16.930 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:17.968 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:19.006 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust, draenic_intellect_potion
0:20.044 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:21.083 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:22.120 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, shadow_word_insanity
0:23.158 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, shadow_word_insanity
0:26.534 mind_blast Fluffy_Pillow 158960.6/160000: 99% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:27.573 devouring_plague Fluffy_Pillow 159225.6/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:28.611 insanity Fluffy_Pillow 159889.9/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:31.469 mind_blast Fluffy_Pillow 158519.0/160000: 99% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:32.507 mind_spike Fluffy_Pillow 158783.4/160000: 99% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:33.545 mind_spike Fluffy_Pillow 159256.7/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:34.583 mind_spike Fluffy_Pillow 159730.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:35.621 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:36.659 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:37.697 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:38.734 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:39.771 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:40.809 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:41.847 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:43.195 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:44.543 mind_blast Fluffy_Pillow 159262.7/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:45.890 shadow_word_pain Fluffy_Pillow 159724.8/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:47.240 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:48.588 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:49.938 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:51.286 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:55.445 mind_blast Fluffy_Pillow 159461.8/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
0:56.794 devouring_plague Fluffy_Pillow 159925.1/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:58.143 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:01.672 mind_blast Fluffy_Pillow 159058.6/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:03.021 mind_spike Fluffy_Pillow 159521.9/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:04.370 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadowy_insight, glyph_of_mind_flay
1:05.717 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:07.066 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:08.414 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:09.764 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:11.112 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:12.458 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:13.807 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:15.158 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:16.507 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:17.854 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:19.203 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:20.551 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:21.902 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:23.252 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:27.512 mind_blast Fluffy_Pillow 159526.4/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:28.861 devouring_plague Fluffy_Pillow 159989.8/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:30.209 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:33.651 mind_blast Fluffy_Pillow 159002.9/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:35.000 halo Fluffy_Pillow 159466.2/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:36.349 mind_spike Fluffy_Pillow 158729.6/160000: 99% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:37.697 mind_spike Fluffy_Pillow 159401.3/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:39.045 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:40.393 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:41.741 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:43.089 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:44.437 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:45.788 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:47.137 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:48.485 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:49.833 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:51.182 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:52.529 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:53.876 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:55.224 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:56.572 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:00.840 mind_blast Fluffy_Pillow 159531.5/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:02.189 devouring_plague Fluffy_Pillow 159994.9/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:03.536 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:07.100 mind_blast Fluffy_Pillow 159081.0/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:08.448 mind_spike Fluffy_Pillow 159543.7/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:09.798 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:11.146 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:12.496 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:13.844 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:15.195 halo Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:16.543 mind_spike Fluffy_Pillow 159262.7/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:17.894 mind_blast Fluffy_Pillow 159936.4/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:19.243 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:20.593 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:21.943 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:23.291 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:24.639 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:25.989 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:27.337 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:28.683 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:30.034 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:34.487 mind_blast Fluffy_Pillow 159649.9/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:35.837 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:37.185 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:40.759 mind_blast Fluffy_Pillow 159087.4/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:42.107 mind_spike Fluffy_Pillow 159550.1/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:43.455 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:44.803 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadowy_insight, glyph_of_mind_flay
2:46.152 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:47.500 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:48.848 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:50.196 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:51.545 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:52.893 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:54.243 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:55.590 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:56.938 mind_blast Fluffy_Pillow 159262.7/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:58.287 shadow_word_pain Fluffy_Pillow 159726.1/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:59.636 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:00.986 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:02.334 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:03.683 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:07.974 mind_blast Fluffy_Pillow 159546.2/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:09.321 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:10.669 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:14.244 mind_blast Fluffy_Pillow 159088.0/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:15.591 shadowfiend Fluffy_Pillow 159550.1/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:16.940 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:18.287 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:19.636 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:20.984 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:22.333 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:23.683 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:25.032 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:26.380 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:27.729 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadowy_insight, glyph_of_mind_flay
3:29.077 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:30.425 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:31.773 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:33.123 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:34.471 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:35.818 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:40.106 mind_blast Fluffy_Pillow 159544.3/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:41.456 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:42.803 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:46.441 mind_blast Fluffy_Pillow 159128.3/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:47.791 halo Fluffy_Pillow 159592.3/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:49.139 mind_spike Fluffy_Pillow 158855.0/160000: 99% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:50.489 mind_spike Fluffy_Pillow 159528.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:51.837 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:53.185 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:54.533 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:55.881 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:57.231 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:58.581 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:59.930 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
4:01.279 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
4:02.629 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
4:03.978 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
4:05.327 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:06.676 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:08.024 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:09.373 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:10.722 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:14.308 mind_blast Fluffy_Pillow 159095.0/160000: 99% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:15.658 shadow_word_death Fluffy_Pillow 159559.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
4:17.006 shadow_word_death Fluffy_Pillow 159621.8/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:18.354 devouring_plague Fluffy_Pillow 159684.5/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:19.702 potion Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:19.702 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:21.051 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:23.398 insanity Fluffy_Pillow 159902.1/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:24.994 devouring_plague Fluffy_Pillow 159323.5/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay, draenic_intellect_potion
4:26.343 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:27.692 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:29.042 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:30.392 halo Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:31.739 mind_blast Fluffy_Pillow 159262.1/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:33.087 mind_spike Fluffy_Pillow 159724.8/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:34.435 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:35.784 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:37.131 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:38.479 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:39.828 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:41.177 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:42.525 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:43.874 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:45.221 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:48.807 mind_blast Fluffy_Pillow 159095.0/160000: 99% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:50.157 shadow_word_death Fluffy_Pillow 159559.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
4:51.506 shadow_word_death Fluffy_Pillow 159622.4/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:52.855 devouring_plague Fluffy_Pillow 159685.8/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:54.205 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:55.553 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:57.792 insanity Fluffy_Pillow 159833.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:59.407 devouring_plague Fluffy_Pillow 159266.6/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
5:00.754 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb shadow_word_insanity, glyph_of_mind_flay

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 880 839 839
Agility 1124 1071 1071
Stamina 4074 3704 3704
Intellect 3870 3423 3313 (2219)
Spirit 782 782 782
Health 244440 222240 0
Mana 160000 160000 0
Shadow Orb 5 5 0
Spell Power 5309 4379 956
Crit 21.69% 16.69% 1286
Haste 11.59% 6.27% 522
Multistrike 11.33% 6.33% 418
Damage / Heal Versatility 5.18% 2.18% 284
ManaReg per Second 640 640 0
Mastery 50.00% 35.23% 670
Armor 1184 592 592
Run Speed 0 0 154

Talents

Level
15 Desperate Prayer Spectral Guise Angelic Bulwark
30 Body and Soul Angelic Feather Phantasm
45 Surge of Darkness (Shadow Priest) Mindbender Insanity (Shadow Priest)
60 Void Tendrils Psychic Scream Dominate Mind
75 Twist of Fate Power Infusion Shadowy Insight (Shadow Priest)
90 Cascade (Shadow Priest) Divine Star (Shadow Priest) Halo (Shadow Priest)
100 Clarity of Power (Shadow Priest) Void Entropy (Shadow Priest) Auspicious Spirits (Shadow Priest)

Profile

priest="Swæty"
origin="http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/13/55890701-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=enchanting=679/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!2022220
glyphs=fade/mind_blast/mind_flay/dark_archangel/heavens/shadow_ravens
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/shadowform,if=!buff.shadowform.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/mind_spike

# Executed every time the actor is available.

actions=shadowform,if=!buff.shadowform.up
actions+=/potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
actions+=/call_action_list,name=decision

actions.decision=call_action_list,name=cop_dotweave,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct>20&active_enemies<=5
actions.decision+=/call_action_list,name=cop_mfi,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct<=20
actions.decision+=/call_action_list,name=cop,if=talent.clarity_of_power.enabled
actions.decision+=/call_action_list,name=vent,if=talent.void_entropy.enabled
actions.decision+=/call_action_list,name=main

actions.pvp_dispersion=call_action_list,name=decision,if=cooldown.dispersion.remains>0
actions.pvp_dispersion+=/dispersion,interrupt=1
actions.pvp_dispersion+=/call_action_list,name=decision

actions.main=mindbender,if=talent.mindbender.enabled
actions.main+=/shadowfiend,if=!talent.mindbender.enabled
actions.main+=/shadow_word_death,if=target.health.pct<20&shadow_orb<=4,cycle_targets=1
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
actions.main+=/devouring_plague,if=shadow_orb=5&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb=5
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)&!target.dot.devouring_plague_tick.ticking&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.main+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.main+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/insanity,chain=1,if=active_enemies<=2,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>2
actions.main+=/cascade,if=talent.cascade.enabled&active_enemies>2&target.distance<=40
actions.main+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24
actions.main+=/shadow_word_pain,if=talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react,cycle_targets=1
actions.main+=/shadow_word_pain,if=!talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/devouring_plague,if=!talent.void_entropy.enabled&shadow_orb>=3&ticks_remain<=1
actions.main+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.main+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.main+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.main+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions.main+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&cooldown.mind_blast.remains&active_enemies<=1
actions.main+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions.main+=/divine_star,if=talent.divine_star.enabled&target.distance<=28&active_enemies>1
actions.main+=/mind_sear,chain=1,if=active_enemies>=4,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/shadow_word_pain,if=shadow_orb>=2&ticks_remain<=3&talent.insanity.enabled
actions.main+=/vampiric_touch,if=shadow_orb>=2&ticks_remain<=3.5&talent.insanity.enabled
actions.main+=/mind_flay,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.main+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.main+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.main+=/shadow_word_death,moving=1
actions.main+=/shadow_word_pain,moving=1,cycle_targets=1

actions.vent=mindbender,if=talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/shadowfiend,if=!talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/void_entropy,if=shadow_orb=3&!ticking&target.time_to_die>60&active_enemies=1
actions.vent+=/void_entropy,if=!dot.void_entropy.ticking&shadow_orb=5&active_enemies>=1&target.time_to_die>60,cycle_targets=1,max_cycle_targets=(60%(cooldown.mind_blast.duration*3*spell_haste))
actions.vent+=/devouring_plague,if=dot.void_entropy.ticking&dot.void_entropy.remains<=gcd*2&cooldown_react,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<10,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<20,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains,cycle_targets=1
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>=4
actions.vent+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.vent+=/devouring_plague,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb>=3,cycle_targets=1
actions.vent+=/mind_blast,if=active_enemies<=10&cooldown_react&shadow_orb<=4
actions.vent+=/shadow_word_death,if=target.health.pct<20&cooldown_react&shadow_orb<=4,cycle_targets=1
actions.vent+=/shadow_word_pain,if=shadow_orb=4&remains<(18*0.50)&set_bonus.tier17_2pc&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.vent+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/insanity,chain=1,if=active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.vent+=/shadow_word_pain,if=remains<(18*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/vampiric_touch,if=remains<(15*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/cascade,if=talent.cascade.enabled&target.distance<=40&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.up&cooldown_react&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_sear,chain=1,if=active_enemies>=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_flay,if=cooldown.mind_blast.remains>0.5*gcd,interrupt=1,chain=1
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.vent+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.vent+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/shadow_word_pain,moving=1,cycle_targets=1

actions.cop_dotweave=devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
actions.cop_dotweave+=/devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
actions.cop_dotweave+=/devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
actions.cop_dotweave+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.cop_dotweave+=/mind_blast,if=shadow_orb<=4&cooldown_react
actions.cop_dotweave+=/shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
actions.cop_dotweave+=/insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_dotweave+=/divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_dotweave+=/cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_dotweave+=/shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
actions.cop_dotweave+=/mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
actions.cop_dotweave+=/mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_dotweave+=/mind_spike
actions.cop_dotweave+=/shadow_word_death,moving=1
actions.cop_dotweave+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_dotweave+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_dotweave+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_dotweave+=/shadow_word_pain,moving=1

actions.cop_mfi=devouring_plague,if=shadow_orb=5
actions.cop_mfi+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.cop_mfi+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop_mfi+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop_mfi+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
actions.cop_mfi+=/mindbender,if=talent.mindbender.enabled
actions.cop_mfi+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop_mfi+=/shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_mfi+=/mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_mfi+=/mind_spike
actions.cop_mfi+=/shadow_word_death,moving=1
actions.cop_mfi+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_mfi+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

actions.cop=devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))&primary_target=0,cycle_targets=1
actions.cop+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))
actions.cop+=/mind_blast,if=mind_harvest=0,cycle_targets=1
actions.cop+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop+=/mindbender,if=talent.mindbender.enabled
actions.cop+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop+=/shadow_word_pain,if=miss_react&!ticking&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/vampiric_touch,if=remains<cast_time&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/mind_sear,if=active_enemies>=5,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike,if=active_enemies<=4&buff.surge_of_darkness.react
actions.cop+=/mind_sear,if=active_enemies>=3,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_flay,if=target.dot.devouring_plague_tick.ticks_remain>1&active_enemies=1,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike
actions.cop+=/shadow_word_death,moving=1
actions.cop+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop+=/halo,moving=1,if=talent.halo.enabled&target.distance<=30
actions.cop+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

head=crown_of_power,id=118942
neck=braided_magnaron_plait,id=120084,enchant=40crit
shoulders=felflame_spaulders,id=109948,bonus_id=523/524,gems=35mastery
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=560,enchant=100crit
chest=robes_of_volatile_ice,id=114500,bonus_id=81/563,gems=35crit
shirt=paper_shirt,id=98087
tabard=argent_crusaders_tabard,id=46874
wrists=bracers_of_volatile_ice,id=114493,bonus_id=220/560
hands=gloves_of_arcane_mystery,id=109844,bonus_id=499/523/524,gems=35crit
waist=cord_of_arcane_mystery,id=109824,bonus_id=42/524
legs=lightbinder_leggings,id=109807,bonus_id=523/524,gems=35mastery
feet=sandals_of_volatile_ice,id=114501,bonus_id=142/563,gems=35crit
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=darkflame_loop,id=109766,bonus_id=524,enchant=30crit
trinket1=grandiose_power,id=114550,bonus_id=42
trinket2=crushtos_runic_alarm,id=110000,bonus_id=524
main_hand=hoof_of_yalnu,id=119181,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=2814
# gear_intellect=2219
# gear_spell_power=956
# gear_crit_rating=1286
# gear_haste_rating=497
# gear_mastery_rating=670
# gear_armor=592
# gear_multistrike_rating=418
# gear_versatility_rating=284
# gear_speed_rating=154

Ralana

Ralana : 20892 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
20892.5 20892.5 7.6 / 0.036% 2379.7 / 11.4% 715.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
29.2 29.2 Energy 31.58% 43.7 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced
Talents
  • 15: Shadow Focus
  • 30: Combat Readiness
  • 45: Elusiveness
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Venom Rush
  • Talent Calculator
Glyphs
  • Glyph of Energy
  • Glyph of Feint
  • Glyph of Disappearance
  • Glyph of Poisons
  • Glyph of Safe Fall
  • Glyph of Decoy
Professions
  • engineering: 659
  • jewelcrafting: 659

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ralana+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:28720|19681|18397|9744|7307|4545|2232&chds=0,57439&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++28720++eviscerate,C79C6E,0,0,15|t++19681++killing_spree,C79C6E,1,0,15|t++18397++ambush,C79C6E,2,0,15|t++9744++sinister_strike,C79C6E,3,0,15|t++7307++revealing_strike,C79C6E,4,0,15|t++4545++auto_attack_mh,C79C6E,5,0,15|t++2232++auto_attack_oh,C79C6E,6,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:21,19,16,14,11,10,4,2,2,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|sinister_strike|eviscerate|main_gauche|auto_attack_oh|instant_poison|killing_spree_mh|ambush|killing_spree_oh|revealing_strike&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ralana+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:begjnqty2668765445665431ywurnlkjhgedbZYXVVVWXXYZZabcdfghijjkkllkkjihgfdcbaZYYYYYZabcdfgilnprtuwyz0122210zywusqnljhgecaZXWVVUUUUVVWWXXYZabbccdddeeeedddccbbaZZYYYYYYYYZZabccdeghijkllmnnnnnnmmlkjihgedcbaZYYXWWWWWWWXXYYZZabbcdeefgghhhiihhhhgffedcbbaZYYXXXXXXXXYYZabcdefghijklmnnnooonnnmlkkjigfeedcbaaZZYYYYYYYZZZZaaaaaaaabbaaaaaaZZZZZZZZZZZZaaabbccdeefghhiijjjjjjjiihgecaYWUSQPN&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.552259,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=20892|max=37831&chxp=1,1,55,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ralana+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,5,5,10,30,43,67,101,140,198,315,392,500,653,798,938,1116,1248,1348,1432,1388,1583,1530,1435,1351,1272,1099,1020,919,756,661,633,492,369,295,235,176,131,92,66,43,36,27,17,14,9,4,3,1,3&chds=0,1583&chbh=5&chxt=x&chxl=0:|min=18831|avg=20892|max=23434&chxp=0,1,45,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:41.1,11.3,6.2,4.0,3.1,2.4,0.4,31.6&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=sinister_strike 123.8s|eviscerate 33.9s|killing_spree 18.6s|revealing_strike 12.2s|slice_and_dice 9.5s|ambush 7.1s|preparation 1.2s|waiting 95.0s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ralana 20892
ambush 435 2.1% 7.1 48.84sec 18478 18397 Direct 7.1 14500 28983 17552 21.1% 1.2 4355 8682 21.3%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 7.08 0.00 0.00 1.0045 0.0000 130764.51 200964.41 34.93 18396.81 18396.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.26 21.33% 8681.85 6529 12051 2032.98 0 12051 2300 3535 8.18
multistrike 0.98 78.67% 4355.46 3264 6026 2757.68 0 6026 4256 6541 22.11
hit 5.59 78.93% 14499.63 10881 20086 14530.47 10881 18204 80984 124460 34.93
crit 1.49 21.07% 28983.48 21762 40171 23461.90 0 40171 43224 66429 28.25
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 4481 21.5% 218.1 1.38sec 6176 4545 Direct 218.1 4840 9681 5865 21.2% 38.5 1453 2905 21.2%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 218.06 218.06 0.00 0.00 1.3588 0.0000 1346651.52 2069590.76 34.93 4545.15 4545.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.14 21.16% 2905.06 2245 4156 2905.20 0 4156 23635 36324 34.92
multistrike 30.32 78.84% 1452.70 1123 2078 1453.67 1269 1665 44048 67695 34.93
hit 171.87 78.82% 4840.17 3742 6926 4843.30 4664 5050 831894 1278490 34.93
crit 46.18 21.18% 9680.62 7485 13852 9686.54 8704 10755 447074 687082 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2199 10.5% 214.5 1.40sec 3082 2232 Direct 214.5 2417 4832 2927 21.1% 37.8 725 1450 21.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.46 214.46 0.00 0.00 1.3805 0.0000 660884.41 1015674.98 34.93 2232.32 2232.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.99 21.13% 1449.97 1123 2078 1449.98 0 2078 11587 17808 34.91
multistrike 29.83 78.87% 724.84 561 1039 725.25 630 841 21620 33227 34.93
hit 169.15 78.87% 2416.51 1871 3463 2418.02 2334 2513 408761 628201 34.93
crit 45.31 21.13% 4831.93 3742 6926 4835.10 4372 5415 218916 336439 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
eviscerate 3239 15.5% 36.2 7.93sec 26869 28720 Direct 36.2 21062 42142 25523 21.2% 6.4 6313 12636 21.1%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.22 36.22 0.00 0.00 0.9356 0.0000 973247.54 1495727.79 34.93 28719.53 28719.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.35 21.10% 12636.31 8670 16637 9291.82 0 16637 17000 26126 25.65
multistrike 5.03 78.90% 6313.27 4335 8318 6278.49 0 8318 31765 48818 34.71
hit 28.56 78.84% 21062.32 14449 27728 21086.25 19276 23158 601488 924392 34.93
crit 7.66 21.16% 42141.65 28899 55457 42175.86 0 55457 322994 496391 34.93
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
instant_poison 2008 9.6% 210.0 1.46sec 2871 0 Direct 210.0 2250 4501 2727 21.2% 37.0 675 1350 21.1%  

Stats details: instant_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 210.05 210.05 0.00 0.00 0.0000 0.0000 602987.74 602987.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.83 21.15% 1350.33 1027 1970 1350.97 0 1970 10572 10572 0.00
multistrike 29.19 78.85% 675.43 513 985 675.93 582 788 19717 19717 0.00
hit 165.60 78.84% 2250.39 1712 3284 2252.14 2107 2413 372671 372671 0.00
crit 44.44 21.16% 4500.72 3423 6568 4503.94 3965 5131 200028 200028 0.00
 
DPS Timeline Chart
 

Action details: instant_poison

Static Values
  • id:157607
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157607
  • name:Instant Poison
  • school:nature
  • tooltip:
  • description:{$@spelldesc157584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of instantly poisoning the enemy for {$157607s1=0 to 2} Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.264000
  • spell_power_mod.direct:0.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
killing_spree 0 (1218) 0.0% (5.8%) 5.7 56.90sec 63663 19681

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.74 5.74 40.01 40.01 3.2349 0.4282 0.00 0.00 0.00 19681.35 19681.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.5 78.84% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.5 21.16% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time_to_die>=44
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    killing_spree_mh 812 3.9% 40.0 6.99sec 6092 0 Periodic 40.0 4650 9296 5633 21.2% 7.1 2145 4289 21.1% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.01 0.00 0.00 40.01 0.0000 0.0000 243717.11 364697.75 33.17 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.5 21.13% 4288.74 3229 5960 3323.59 0 5960 6405 6405 0.00
multistrike 5.6 78.87% 2145.17 1614 2980 2137.43 0 2980 11956 11956 0.00
hit 31.5 78.84% 4650.32 3502 6464 4653.48 3917 5535 146680 225424 34.93
crit 8.5 21.16% 9296.01 7003 12927 9302.07 0 12927 78676 120913 34.92
 
DPS Timeline Chart
 

Action details: killing_spree_mh

Static Values
  • id:57841
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57841
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    killing_spree_oh 406 1.9% 40.0 6.99sec 3044 0 Periodic 40.0 2325 4651 2815 21.1% 7.1 1071 2143 21.0% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.01 0.00 0.00 40.01 0.0000 0.0000 121785.20 182233.48 33.17 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.5 21.04% 2143.50 1614 2980 1656.87 0 2980 3195 3195 0.00
multistrike 5.6 78.96% 1071.00 807 1490 1067.06 0 1490 5990 5990 0.00
hit 31.6 78.94% 2324.78 1751 3232 2326.54 1954 2737 73418 112832 34.93
crit 8.4 21.06% 4650.84 3502 6464 4654.05 0 6464 39181 60216 34.93
 
DPS Timeline Chart
 

Action details: killing_spree_oh

Static Values
  • id:57842
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57842
  • name:Killing Spree Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_gauche 3000 14.4% 216.9 1.46sec 4152 0 Direct 216.9 3257 6509 3944 21.1% 38.2 977 1954 21.1%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 216.94 216.94 0.00 0.00 0.0000 0.0000 900849.33 1384463.18 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.08 21.14% 1953.77 1471 2715 1953.87 0 2715 15791 24269 34.92
multistrike 30.15 78.86% 976.68 735 1357 977.18 850 1142 29443 45249 34.93
hit 171.10 78.87% 3256.67 2451 4525 3258.65 3089 3474 557228 856371 34.93
crit 45.84 21.13% 6509.45 4902 9049 6513.63 5845 7400 298388 458575 34.93
 
DPS Timeline Chart
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.40
 
revealing_strike 296 1.4% 12.7 24.25sec 6997 7307 Direct 12.7 5487 10968 6645 21.1% 2.2 1645 3295 21.2%  

Stats details: revealing_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.70 12.70 96.51 96.51 0.9576 3.0000 88865.28 1127009.05 92.11 294.57 7307.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.47 21.19% 3294.98 2521 4654 1256.30 0 4654 1564 2404 13.32
multistrike 1.77 78.81% 1645.12 1261 2327 1376.49 0 2327 2904 4464 29.20
hit 10.02 78.86% 5486.63 4202 7756 5489.23 4202 6666 54955 84457 34.93
crit 2.68 21.14% 10967.52 8404 15513 10384.49 0 15513 29442 45248 33.06
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.1 78.85% 0.00 0 0 0.00 0 0 0 780988 100.00
crit 20.4 21.15% 0.00 0 0 0.00 0 0 0 209449 100.00
 
DPS Timeline Chart
 

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Spelldata
  • id:84617
  • name:Revealing Strike
  • school:physical
  • tooltip:Reveals weakness, increasing the effectiveness of the Rogue's offensive finishing moves by $w3%, and giving the Rogue's Sinister Strikes a {$h=0}% chance to generate an extra combo point.
  • description:Deals $sw1 Physical damage, increasing the effect of your offensive finishing moves on that target by {$s3=35}%, and giving your Sinister Strike a {$s6=25}% chance to generate an extra combo point. Lasts {$d=24 seconds}. Awards {$s2=1} combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
sinister_strike 4016 19.2% 131.6 2.25sec 9171 9744 Direct 131.6 7190 14379 8710 21.1% 23.2 2158 4316 21.2%  

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.57 131.57 0.00 0.00 0.9412 0.0000 1206647.73 1854427.03 34.93 9744.39 9744.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.91 21.15% 4316.20 3361 6205 4280.55 0 6205 21179 32548 34.64
multistrike 18.29 78.85% 2157.88 1681 3103 2159.34 1777 2669 39469 60657 34.93
hit 103.75 78.85% 7189.67 5602 10342 7194.57 6889 7551 745917 1146356 34.93
crit 27.82 21.15% 14379.36 11205 20683 14388.51 12621 16806 400084 614865 34.93
 
DPS Timeline Chart
 

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.revealing_strike.ticking
Spelldata
  • id:1752
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:An instant strike that causes $sw3 Physical damage.{$?s79327=false}[ Awards {$s2=0} combo $lpoint:points;.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.60
 
Simple Action Stats Execute Interval
Ralana
adrenaline_rush 3.9 85.99sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.90 3.90 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 3.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time_to_die>=44
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
preparation 1.2 313.61sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.22 1.22 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>30
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
slice_and_dice 9.8 32.15sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 9.80 0.00 0.00 0.9666 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 9.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.marked_for_death.enabled
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 6.1 48.83sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.08 6.08 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 6.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
adrenaline_rush 3.9 0.0 86.0sec 86.0sec 18.94% 19.36% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:18.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
anticipation 23.9 55.8 12.3sec 3.6sec 46.56% 46.57% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:14.30%
  • anticipation_2:12.04%
  • anticipation_3:10.17%
  • anticipation_4:7.16%
  • anticipation_5:2.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bandits_guile 7.8 82.3 40.0sec 3.3sec 94.99% 94.99% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bandits_guile
  • max_stacks:12
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bandits_guile_1:5.47%
  • bandits_guile_2:5.59%
  • bandits_guile_3:5.71%
  • bandits_guile_4:5.59%
  • bandits_guile_5:5.53%
  • bandits_guile_6:5.48%
  • bandits_guile_7:5.39%
  • bandits_guile_8:5.41%
  • bandits_guile_9:5.45%
  • bandits_guile_10:5.30%
  • bandits_guile_11:4.96%
  • bandits_guile_12:35.11%

Trigger Attempt Success

  • trigger_pct:68.48%

Spelldata details

  • id:84654
  • name:Bandit's Guile
  • tooltip:
  • description:Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 20.33% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
deep_insight 7.2 0.0 42.3sec 42.3sec 35.11% 10.58% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_deep_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • deep_insight_1:35.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84747
  • name:Deep Insight
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 86.1sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
exquisite_proficiency 4.9 0.0 68.2sec 68.2sec 31.42% 31.43% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_exquisite_proficiency
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:581.00

Stack Uptimes

  • exquisite_proficiency_1:31.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:133630
  • name:Exquisite Proficiency
  • tooltip:Increases Mastery rating by {$s1=609}.
  • description:Increases Mastery rating by {$s1=609} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
killing_spree 2.2 0.0 168.1sec 168.1sec 2.20% 2.20% 13.2(13.2)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:3.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • killing_spree_1:2.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51690
  • name:Killing Spree
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:120.00
  • default_chance:0.00%
mark_of_warsong 5.0 2.2 63.2sec 40.9sec 39.10% 39.11% 2.2(12.9)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_mark_of_warsong
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:haste_rating
  • amount:100.00

Stack Uptimes

  • mark_of_warsong_1:3.17%
  • mark_of_warsong_2:3.31%
  • mark_of_warsong_3:3.47%
  • mark_of_warsong_4:3.63%
  • mark_of_warsong_5:3.79%
  • mark_of_warsong_6:3.97%
  • mark_of_warsong_7:4.15%
  • mark_of_warsong_8:4.34%
  • mark_of_warsong_9:4.53%
  • mark_of_warsong_10:4.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159675
  • name:Mark of Warsong
  • tooltip:Haste increased by $w1.
  • description:Haste increased by {$s1=100}.
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
mark_of_warsong_oh (_oh) 5.0 2.2 63.3sec 41.0sec 39.03% 39.03% 2.2(12.8)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_mark_of_warsong_oh
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:haste_rating
  • amount:100.00

Stack Uptimes

  • mark_of_warsong_oh_1:3.17%
  • mark_of_warsong_oh_2:3.31%
  • mark_of_warsong_oh_3:3.46%
  • mark_of_warsong_oh_4:3.62%
  • mark_of_warsong_oh_5:3.79%
  • mark_of_warsong_oh_6:3.96%
  • mark_of_warsong_oh_7:4.14%
  • mark_of_warsong_oh_8:4.33%
  • mark_of_warsong_oh_9:4.52%
  • mark_of_warsong_oh_10:4.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159675
  • name:Mark of Warsong
  • tooltip:Haste increased by $w1.
  • description:Haste increased by {$s1=100}.
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
moderate_insight 7.4 21.9 41.5sec 9.6sec 21.13% 37.77% 21.9(21.9)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_moderate_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • moderate_insight_1:21.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84746
  • name:Moderate Insight
  • tooltip:Damage dealt increased by $s2%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shallow_insight 7.6 22.6 40.5sec 9.5sec 21.98% 39.20% 22.6(22.6)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_shallow_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • shallow_insight_1:21.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84745
  • name:Shallow Insight
  • tooltip:Damage dealt increased by {$s1=10}%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 1.1 8.7 249.6sec 32.1sec 99.64% 100.00% 8.7(8.7)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 6.2 0.0 52.1sec 59.3sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
turbulent_vial_of_toxin 3.8 0.0 90.4sec 90.5sec 18.31% 18.32% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_turbulent_vial_of_toxin
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1120.00

Stack Uptimes

  • turbulent_vial_of_toxin_1:18.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:176883
  • name:Turbulent Vial of Toxin
  • tooltip:Mastery increased by {$s1=870}.
  • description:Grants {$s1=870} Mastery for {$d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
vanish 6.1 0.0 48.8sec 48.8sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ralana
ambush Energy 7.1 201.4 28.5 28.5 649.3
eviscerate Energy 36.2 1267.8 35.0 35.0 767.7
eviscerate Combo Points 36.2 181.1 5.0 5.0 5373.8
revealing_strike Energy 12.7 508.0 40.0 40.0 174.9
sinister_strike Energy 131.6 6578.6 50.0 50.0 183.4
slice_and_dice Energy 9.8 245.0 25.0 25.0 0.0
slice_and_dice Combo Points 9.8 43.8 4.5 4.5 0.0
Resource Gains Type Count Total Average Overflow
ambush Combo Points 8.19 14.15 (6.01%) 1.73 0.00 0.00%
revealing_strike Combo Points 12.55 12.55 (5.33%) 1.00 0.00 0.00%
sinister_strike Combo Points 163.95 163.95 (69.58%) 1.00 0.00 0.00%
energy_regen Energy 1119.82 4660.65 (53.77%) 4.16 169.53 3.51%
leech Health 1325.82 0.00 (0.00%) 0.00 13465.79 100.00%
adrenaline_rush Energy 187.53 929.51 (10.72%) 4.96 27.07 2.83%
combat_potency Energy 137.87 1954.11 (22.54%) 14.17 113.90 5.51%
ruthlessness Energy 44.97 1124.20 (12.97%) 25.00 0.00 0.00%
ruthlessness Combo Points 44.98 44.98 (19.09%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.80 29.15
Combo Points 0.76 0.75
Combat End Resource Mean Min Max
Energy 28.77 0.00 135.00
Combo Points 4.00 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.7%
shadow_reflection-Energy Cap 1.7%

Procs

Count Interval
Anticipation Charges (wasted) 6.1 46.1sec

Statistics & Data Analysis

Fight Length
Sample Data Ralana Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Ralana Damage Per Second
Count 25000
Mean 20892.48
Minimum 18831.22
Maximum 23434.37
Spread ( max - min ) 4603.15
Range [ ( max - min ) / 2 * 100% ] 11.02%
Standard Deviation 612.5143
5th Percentile 19922.40
95th Percentile 21932.58
( 95th Percentile - 5th Percentile ) 2010.18
Mean Distribution
Standard Deviation 3.8739
95.00% Confidence Intervall ( 20884.89 - 20900.08 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3301
0.1 Scale Factor Error with Delta=300 3202
0.05 Scale Factor Error with Delta=300 12810
0.01 Scale Factor Error with Delta=300 320269
Distribution Chart
DPS(e)
Sample Data Ralana Damage Per Second (Effective)
Count 25000
Mean 20892.48
Minimum 18831.22
Maximum 23434.37
Spread ( max - min ) 4603.15
Range [ ( max - min ) / 2 * 100% ] 11.02%
Damage
Sample Data Ralana Damage
Count 25000
Mean 6276400.36
Minimum 4585831.07
Maximum 8132321.67
Spread ( max - min ) 3546490.60
Range [ ( max - min ) / 2 * 100% ] 28.25%
DTPS
Sample Data Ralana Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ralana Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ralana Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ralana Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ralana Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ralana Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RalanaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ralana Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=frosty_stew
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 marked_for_death
7 0.00 slice_and_dice,if=talent.marked_for_death.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
9 0.00 kick
A 1.22 preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
B 3.77 use_item,slot=trinket1
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent,if=energy<60
F 0.00 blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
G 0.00 shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
H 7.08 ambush
I 6.08 vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
J 9.80 slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
K 0.00 call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
L 0.00 call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
M 0.00 marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
N 0.00 call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
O 0.00 call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))
actions.adrenaline_rush
# count action,conditions
P 3.85 adrenaline_rush,if=time_to_die>=44
Q 0.03 adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
R 0.02 adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5
actions.killing_spree
# count action,conditions
S 5.68 killing_spree,if=time_to_die>=44
T 0.00 killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
U 0.04 killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
V 0.00 killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
W 0.03 killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5
actions.generator Combo point generators
# count action,conditions
X 12.70 revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Y 131.57 sinister_strike,if=dot.revealing_strike.ticking
actions.finisher Combo point finishers
# count action,conditions
Z 0.00 death_from_above
a 36.22 eviscerate

Sample Sequence

01245BHJSPXYYYYJYYYYYYYaYaYYIHAIHaXaYYYYaYYYYYYaYJYYYYXaYSaYYYaYYYXYYJYIHYYBYaYYP8YYaYYaYXaYYaYYYYSaYYYJYYXYYYaYYYIHaYaYXaYYYJYYYXYYYaBJYSYYYYPYaXaYYYYaYYYaYYYIHYYaYJYYXYYaYYYaYSYaYXaYYYaYYJYYYIHYYBPXaYYYYaYYYaaYYYYaJYXSYYYY

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre food Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre apply_poison Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 use_item_turbulent_vial_of_toxin Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 ambush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion, turbulent_vial_of_toxin
0:01.004 slice_and_dice Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bloodlust, exquisite_proficiency, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
0:02.009 killing_spree Fluffy_Pillow 130.1/135: 96% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
0:05.367 adrenaline_rush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
0:05.367 revealing_strike Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
0:06.172 sinister_strike Fluffy_Pillow 128.2/135: 95% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
0:06.976 sinister_strike Fluffy_Pillow 111.2/135: 82% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
0:07.780 sinister_strike Fluffy_Pillow 109.2/135: 81% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(2), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), draenic_agility_potion, turbulent_vial_of_toxin
0:08.584 sinister_strike Fluffy_Pillow 91.9/135: 68% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(3), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), draenic_agility_potion, turbulent_vial_of_toxin
0:09.388 slice_and_dice Fluffy_Pillow 74.6/135: 55% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), draenic_agility_potion, turbulent_vial_of_toxin
0:10.191 sinister_strike Fluffy_Pillow 107.1/135: 79% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), draenic_agility_potion, turbulent_vial_of_toxin
0:10.997 sinister_strike Fluffy_Pillow 89.6/135: 66% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), draenic_agility_potion, turbulent_vial_of_toxin
0:11.802 sinister_strike Fluffy_Pillow 72.0/135: 53% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), draenic_agility_potion, turbulent_vial_of_toxin
0:12.606 sinister_strike Fluffy_Pillow 69.1/135: 51% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(4), draenic_agility_potion, turbulent_vial_of_toxin
0:13.409 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(4), draenic_agility_potion, turbulent_vial_of_toxin
0:14.213 Waiting 0.100 sec 48.2/135: 36% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(3), draenic_agility_potion, turbulent_vial_of_toxin
0:14.313 sinister_strike Fluffy_Pillow 52.1/135: 39% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(3), draenic_agility_potion, turbulent_vial_of_toxin
0:15.119 Waiting 0.500 sec 34.0/135: 25% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(3), draenic_agility_potion
0:15.619 sinister_strike Fluffy_Pillow 53.8/135: 40% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(3), draenic_agility_potion
0:16.423 eviscerate Fluffy_Pillow 35.4/135: 26% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(2), draenic_agility_potion
0:17.228 sinister_strike Fluffy_Pillow 57.9/135: 43% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(2), mark_of_warsong_oh(10), draenic_agility_potion
0:18.033 eviscerate Fluffy_Pillow 57.4/135: 43% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(10), draenic_agility_potion
0:18.838 sinister_strike Fluffy_Pillow 96.6/135: 72% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(10), draenic_agility_potion
0:19.643 sinister_strike Fluffy_Pillow 80.5/135: 60% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(9), draenic_agility_potion
0:20.448 vanish Fluffy_Pillow 62.5/135: 46% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(9)
0:20.448 ambush Fluffy_Pillow 62.5/135: 46% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, mark_of_warsong_oh(9)
0:21.453 preparation Fluffy_Pillow 68.4/135: 51% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong_oh(8)
0:22.457 vanish Fluffy_Pillow 89.2/135: 66% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong_oh(8)
0:22.457 ambush Fluffy_Pillow 89.2/135: 66% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, vanish, slice_and_dice, anticipation, mark_of_warsong_oh(8)
0:23.463 eviscerate Fluffy_Pillow 94.9/135: 70% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(7)
0:24.468 revealing_strike Fluffy_Pillow 105.5/135: 78% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(7)
0:25.473 eviscerate Fluffy_Pillow 86.1/135: 64% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(10)
0:26.477 sinister_strike Fluffy_Pillow 112.2/135: 83% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(10)
0:27.481 sinister_strike Fluffy_Pillow 98.3/135: 73% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(9)
0:28.485 sinister_strike Fluffy_Pillow 69.3/135: 51% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(9)
0:29.489 Waiting 0.500 sec 40.2/135: 30% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(8)
0:29.989 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(8)
0:30.994 Waiting 0.678 sec 21.3/135: 16% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(8)
0:31.672 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(7)
0:32.675 sinister_strike Fluffy_Pillow 60.8/135: 45% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice, mark_of_warsong_oh(7)
0:33.679 Waiting 0.700 sec 31.3/135: 23% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile, slice_and_dice, mark_of_warsong_oh(6)
0:34.379 sinister_strike Fluffy_Pillow 60.6/135: 45% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile, slice_and_dice, mark_of_warsong_oh(6)
0:35.385 Waiting 0.100 sec 46.0/135: 34% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(2), slice_and_dice, mark_of_warsong_oh(5)
0:35.485 sinister_strike Fluffy_Pillow 63.0/135: 47% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(2), slice_and_dice, mark_of_warsong_oh(5)
0:36.489 Waiting 0.100 sec 34.0/135: 25% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(3), slice_and_dice, mark_of_warsong(10), mark_of_warsong_oh(5)
0:36.589 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(3), slice_and_dice, mark_of_warsong(10), mark_of_warsong_oh(5)
0:37.594 Waiting 1.200 sec 23.2/135: 17% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(10), mark_of_warsong_oh(4)
0:38.794 sinister_strike Fluffy_Pillow 64.2/135: 48% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(9), mark_of_warsong_oh(4)
0:39.798 Waiting 0.600 sec 35.8/135: 27% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(9), mark_of_warsong_oh(3)
0:40.398 sinister_strike Fluffy_Pillow 63.6/135: 47% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(8), mark_of_warsong_oh(3)
0:41.402 eviscerate Fluffy_Pillow 44.9/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong(8), mark_of_warsong_oh(2)
0:42.407 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, mark_of_warsong(7), mark_of_warsong_oh(2)
0:43.411 Waiting 0.586 sec 17.3/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(7), mark_of_warsong_oh
0:43.997 slice_and_dice Fluffy_Pillow 26.6/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(7), mark_of_warsong_oh
0:45.002 Waiting 0.500 sec 42.4/135: 31% energy | 1.0/5: 20% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6), mark_of_warsong_oh
0:45.502 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6)
0:46.505 Waiting 2.287 sec 15.9/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(5)
0:48.792 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(4)
0:49.797 Waiting 1.300 sec 31.6/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(4)
0:51.097 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(3)
0:52.103 Waiting 1.247 sec 16.7/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(2)
0:53.350 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(2)
0:54.355 Waiting 0.700 sec 30.6/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong
0:55.055 revealing_strike Fluffy_Pillow 41.1/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong
0:56.060 eviscerate Fluffy_Pillow 46.6/135: 35% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong, mark_of_warsong_oh(10)
0:57.065 sinister_strike Fluffy_Pillow 54.3/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, mark_of_warsong(10), mark_of_warsong_oh(10)
0:58.068 killing_spree Fluffy_Pillow 21.9/135: 16% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong(9), mark_of_warsong_oh(9)
1:01.389 eviscerate Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong(8), mark_of_warsong_oh(8)
1:02.394 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7), mark_of_warsong_oh(7)
1:03.397 sinister_strike Fluffy_Pillow 131.8/135: 98% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7), mark_of_warsong_oh(7)
1:04.402 sinister_strike Fluffy_Pillow 98.5/135: 73% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6), mark_of_warsong_oh(6)
1:05.406 eviscerate Fluffy_Pillow 65.0/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6), mark_of_warsong_oh(6)
1:06.411 sinister_strike Fluffy_Pillow 71.4/135: 53% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(5)
1:07.415 sinister_strike Fluffy_Pillow 52.7/135: 39% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), mark_of_warsong_oh(5)
1:08.420 Waiting 1.990 sec 18.8/135: 14% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh(4)
1:10.410 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(3), mark_of_warsong_oh(3)
1:11.416 Waiting 1.575 sec 16.0/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(3), mark_of_warsong_oh(3)
1:12.991 revealing_strike Fluffy_Pillow 40.3/135: 30% energy | 4.0/5: 80% combo_points slice_and_dice, exquisite_proficiency, mark_of_warsong(2), mark_of_warsong_oh(2)
1:13.994 Waiting 1.314 sec 15.7/135: 12% energy | 5.0/5: 100% combo_points slice_and_dice, exquisite_proficiency, mark_of_warsong(2), mark_of_warsong_oh
1:15.308 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points slice_and_dice, exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh
1:16.311 Waiting 1.346 sec 15.4/135: 11% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation, exquisite_proficiency
1:17.657 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong_oh(10)
1:18.661 Waiting 0.586 sec 17.1/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(10)
1:19.247 slice_and_dice Fluffy_Pillow 26.6/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(10)
1:20.251 sinister_strike Fluffy_Pillow 57.7/135: 43% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(9)
1:21.255 Waiting 1.300 sec 23.8/135: 18% energy | 2.0/5: 40% combo_points bandits_guile(3), slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(9)
1:22.555 vanish Fluffy_Pillow 44.5/135: 33% energy | 2.0/5: 40% combo_points bandits_guile(3), slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(8)
1:22.555 ambush Fluffy_Pillow 44.5/135: 33% energy | 2.0/5: 40% combo_points bandits_guile(3), stealth, vanish, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(8)
1:23.559 Waiting 1.275 sec 15.9/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(7)
1:24.834 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(7)
1:25.839 Waiting 1.124 sec 16.8/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(6)
1:26.963 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(10), mark_of_warsong_oh(6)
1:27.968 Waiting 2.051 sec 17.4/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(10), mark_of_warsong_oh(5)
1:30.019 use_item_turbulent_vial_of_toxin Fluffy_Pillow 51.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(9), mark_of_warsong_oh(4)
1:30.019 sinister_strike Fluffy_Pillow 51.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(9), mark_of_warsong_oh(4), turbulent_vial_of_toxin
1:31.025 Waiting 1.109 sec 18.3/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong(8), mark_of_warsong_oh(4), turbulent_vial_of_toxin
1:32.134 eviscerate Fluffy_Pillow 36.4/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong(8), mark_of_warsong_oh(3), turbulent_vial_of_toxin
1:33.138 Waiting 0.200 sec 42.7/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, mark_of_warsong(7), mark_of_warsong_oh(3), turbulent_vial_of_toxin
1:33.338 sinister_strike Fluffy_Pillow 60.9/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, mark_of_warsong(7), mark_of_warsong_oh(2), turbulent_vial_of_toxin
1:34.342 Waiting 0.600 sec 42.0/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6), mark_of_warsong_oh(2), turbulent_vial_of_toxin
1:34.942 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6), mark_of_warsong_oh(2), turbulent_vial_of_toxin
1:35.947 adrenaline_rush Fluffy_Pillow 32.4/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(6), mark_of_warsong_oh, turbulent_vial_of_toxin
1:35.947 potion Fluffy_Pillow 32.4/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(6), mark_of_warsong_oh, turbulent_vial_of_toxin
1:35.947 Waiting 0.600 sec 32.4/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(6), mark_of_warsong_oh, draenic_agility_potion, turbulent_vial_of_toxin
1:36.547 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(5), mark_of_warsong_oh, draenic_agility_potion, turbulent_vial_of_toxin
1:37.351 Waiting 0.700 sec 28.4/135: 21% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong(5), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
1:38.051 sinister_strike Fluffy_Pillow 52.1/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong(5), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
1:38.856 eviscerate Fluffy_Pillow 44.0/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong(4), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
1:39.657 sinister_strike Fluffy_Pillow 75.6/135: 56% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
1:40.462 sinister_strike Fluffy_Pillow 52.3/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, mark_of_warsong(3), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
1:41.266 eviscerate Fluffy_Pillow 58.6/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(2), mark_of_warsong(3), mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
1:42.071 sinister_strike Fluffy_Pillow 74.9/135: 55% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(3), mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
1:42.875 revealing_strike Fluffy_Pillow 50.9/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(2), mark_of_warsong_oh(7), draenic_agility_potion, turbulent_vial_of_toxin
1:43.681 eviscerate Fluffy_Pillow 36.8/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(2), mark_of_warsong_oh(7), draenic_agility_potion, turbulent_vial_of_toxin
1:44.487 sinister_strike Fluffy_Pillow 52.6/135: 39% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong, mark_of_warsong_oh(7), draenic_agility_potion, turbulent_vial_of_toxin
1:45.293 sinister_strike Fluffy_Pillow 58.0/135: 43% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong, mark_of_warsong_oh(6), draenic_agility_potion
1:46.097 Waiting 0.100 sec 33.4/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong, mark_of_warsong_oh(6), draenic_agility_potion
1:46.197 eviscerate Fluffy_Pillow 36.5/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong, mark_of_warsong_oh(6), draenic_agility_potion
1:47.001 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(5), draenic_agility_potion
1:47.803 Waiting 0.300 sec 41.4/135: 31% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(5), draenic_agility_potion
1:48.103 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(5), draenic_agility_potion
1:48.910 Waiting 0.400 sec 40.6/135: 30% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(4), draenic_agility_potion
1:49.310 sinister_strike Fluffy_Pillow 52.8/135: 39% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(4), draenic_agility_potion
1:50.115 Waiting 0.800 sec 27.5/135: 20% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(4), draenic_agility_potion
1:50.915 sinister_strike Fluffy_Pillow 52.0/135: 39% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(3), draenic_agility_potion
1:51.718 killing_spree Fluffy_Pillow 29.7/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong_oh(3), draenic_agility_potion
1:54.956 eviscerate Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong_oh, draenic_agility_potion
1:55.960 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_warsong_oh, draenic_agility_potion
1:56.963 sinister_strike Fluffy_Pillow 100.2/135: 74% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice, mark_of_warsong_oh(10), draenic_agility_potion
1:57.970 sinister_strike Fluffy_Pillow 66.5/135: 49% energy | 4.0/5: 80% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong_oh(10), draenic_agility_potion
1:58.975 slice_and_dice Fluffy_Pillow 32.7/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(9), draenic_agility_potion
1:59.980 Waiting 0.100 sec 48.9/135: 36% energy | 1.0/5: 20% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(9), draenic_agility_potion
2:00.080 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(9), draenic_agility_potion
2:01.086 Waiting 1.229 sec 16.6/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, mark_of_warsong_oh(8)
2:02.315 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, mark_of_warsong_oh(8)
2:03.319 Waiting 1.305 sec 18.0/135: 13% energy | 4.0/5: 80% combo_points bandits_guile(5), shallow_insight, slice_and_dice, mark_of_warsong(10), mark_of_warsong_oh(7)
2:04.624 revealing_strike Fluffy_Pillow 40.4/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(5), shallow_insight, slice_and_dice, mark_of_warsong(9), mark_of_warsong_oh(7)
2:05.629 Waiting 1.947 sec 17.4/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, mark_of_warsong(9), mark_of_warsong_oh(6)
2:07.576 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, mark_of_warsong(8), mark_of_warsong_oh(5)
2:08.580 Waiting 2.096 sec 16.7/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(8), mark_of_warsong_oh(5)
2:10.676 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(6), mark_of_warsong_oh(4)
2:11.681 Waiting 2.090 sec 17.1/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(6), mark_of_warsong_oh(3)
2:13.771 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(5), mark_of_warsong_oh(2)
2:14.774 Waiting 0.671 sec 16.1/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh
2:15.445 eviscerate Fluffy_Pillow 41.5/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh
2:16.450 Waiting 0.200 sec 47.1/135: 35% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh
2:16.650 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(3), mark_of_warsong_oh
2:17.654 Waiting 2.126 sec 15.5/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(3)
2:19.780 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(2), mark_of_warsong_oh(10)
2:20.783 Waiting 1.217 sec 16.6/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(9)
2:22.000 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(8)
2:23.002 vanish Fluffy_Pillow 32.3/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong_oh(8)
2:23.002 ambush Fluffy_Pillow 32.3/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, stealth, vanish, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong_oh(8)
2:24.007 Waiting 1.043 sec 17.4/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(7)
2:25.050 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(7)
2:26.054 Waiting 0.500 sec 42.4/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(6)
2:26.554 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(6)
2:27.558 Waiting 0.436 sec 17.7/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(6)
2:27.994 eviscerate Fluffy_Pillow 40.0/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(5)
2:28.998 Waiting 0.300 sec 46.7/135: 35% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(5)
2:29.298 sinister_strike Fluffy_Pillow 66.6/135: 49% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(5)
2:30.300 Waiting 0.500 sec 33.0/135: 24% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(4)
2:30.800 revealing_strike Fluffy_Pillow 41.2/135: 31% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(4)
2:31.804 Waiting 0.463 sec 17.5/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(4)
2:32.267 eviscerate Fluffy_Pillow 39.9/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6), mark_of_warsong_oh(3)
2:33.272 Waiting 0.300 sec 46.0/135: 34% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(3)
2:33.572 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(3)
2:34.577 Waiting 2.226 sec 16.7/135: 12% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(2)
2:36.803 sinister_strike Fluffy_Pillow 51.4/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh
2:37.809 Waiting 2.228 sec 16.9/135: 13% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3), mark_of_warsong_oh
2:40.037 sinister_strike Fluffy_Pillow 50.6/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(2)
2:41.040 Waiting 0.720 sec 15.7/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong
2:41.760 slice_and_dice Fluffy_Pillow 26.5/135: 20% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_warsong
2:42.765 sinister_strike Fluffy_Pillow 56.5/135: 42% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_warsong
2:43.767 Waiting 1.000 sec 36.3/135: 27% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice
2:44.767 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice
2:45.773 Waiting 1.309 sec 16.0/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
2:47.082 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
2:48.086 Waiting 0.963 sec 15.2/135: 11% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice
2:49.049 revealing_strike Fluffy_Pillow 44.4/135: 33% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice
2:50.053 Waiting 2.087 sec 19.3/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice
2:52.140 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice
2:53.145 Waiting 1.376 sec 15.0/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2)
2:54.521 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2)
2:55.526 Waiting 1.463 sec 15.2/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3)
2:56.989 sinister_strike Fluffy_Pillow 51.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3)
2:57.995 Waiting 1.261 sec 16.7/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(5)
2:59.256 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(5)
3:00.261 use_item_turbulent_vial_of_toxin Fluffy_Pillow 40.2/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice
3:00.261 slice_and_dice Fluffy_Pillow 40.2/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, turbulent_vial_of_toxin
3:01.265 sinister_strike Fluffy_Pillow 55.0/135: 41% energy | 1.0/5: 20% combo_points bandits_guile(6), shallow_insight, slice_and_dice, turbulent_vial_of_toxin
3:02.269 killing_spree Fluffy_Pillow 19.9/135: 15% energy | 2.0/5: 40% combo_points bandits_guile(7), shallow_insight, slice_and_dice, turbulent_vial_of_toxin
3:05.487 sinister_strike Fluffy_Pillow 127.5/135: 94% energy | 2.0/5: 40% combo_points bandits_guile(7), shallow_insight, slice_and_dice, turbulent_vial_of_toxin
3:06.491 sinister_strike Fluffy_Pillow 107.3/135: 79% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, slice_and_dice, turbulent_vial_of_toxin
3:07.497 sinister_strike Fluffy_Pillow 72.2/135: 53% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, turbulent_vial_of_toxin
3:08.502 Waiting 0.900 sec 37.1/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation, turbulent_vial_of_toxin
3:09.402 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation, turbulent_vial_of_toxin
3:10.406 adrenaline_rush Fluffy_Pillow 30.2/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(2), turbulent_vial_of_toxin
3:10.406 Waiting 0.700 sec 30.2/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), turbulent_vial_of_toxin
3:11.106 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), turbulent_vial_of_toxin
3:11.912 eviscerate Fluffy_Pillow 39.7/135: 29% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(3), turbulent_vial_of_toxin
3:12.717 revealing_strike Fluffy_Pillow 68.5/135: 51% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:13.520 eviscerate Fluffy_Pillow 52.3/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:14.326 sinister_strike Fluffy_Pillow 68.4/135: 51% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(10), turbulent_vial_of_toxin
3:15.131 Waiting 0.200 sec 44.4/135: 33% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(10), turbulent_vial_of_toxin
3:15.331 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(10)
3:16.135 Waiting 0.300 sec 26.8/135: 20% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(9)
3:16.435 sinister_strike Fluffy_Pillow 51.4/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(9)
3:17.240 Waiting 0.300 sec 27.2/135: 20% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(9)
3:17.540 sinister_strike Fluffy_Pillow 51.9/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(8)
3:18.342 Waiting 0.300 sec 27.4/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(8)
3:18.642 eviscerate Fluffy_Pillow 36.9/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(8)
3:19.446 sinister_strike Fluffy_Pillow 52.5/135: 39% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(8)
3:20.249 Waiting 0.300 sec 29.0/135: 21% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(7)
3:20.549 sinister_strike Fluffy_Pillow 54.3/135: 40% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(7)
3:21.355 Waiting 0.400 sec 32.0/135: 24% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(7)
3:21.755 sinister_strike Fluffy_Pillow 60.6/135: 45% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(6)
3:22.561 eviscerate Fluffy_Pillow 52.9/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(6)
3:23.366 sinister_strike Fluffy_Pillow 85.1/135: 63% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(6)
3:24.171 sinister_strike Fluffy_Pillow 62.0/135: 46% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(5)
3:24.976 Waiting 0.400 sec 38.7/135: 29% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(5)
3:25.376 sinister_strike Fluffy_Pillow 52.0/135: 39% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(5)
3:26.181 vanish Fluffy_Pillow 15.7/135: 12% energy | 4.0/5: 80% combo_points slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(4)
3:26.181 ambush Fluffy_Pillow 15.7/135: 12% energy | 4.0/5: 80% combo_points stealth, vanish, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(4)
3:27.186 Waiting 1.200 sec 32.2/135: 24% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(4)
3:28.386 sinister_strike Fluffy_Pillow 51.6/135: 38% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(3)
3:29.390 Waiting 1.956 sec 17.7/135: 13% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(3)
3:31.346 sinister_strike Fluffy_Pillow 63.6/135: 47% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(5), mark_of_warsong_oh(2)
3:32.351 Waiting 0.400 sec 29.3/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh
3:32.751 eviscerate Fluffy_Pillow 35.4/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh
3:33.757 sinister_strike Fluffy_Pillow 56.0/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency, mark_of_warsong(4)
3:34.761 Waiting 0.345 sec 21.3/135: 16% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(3)
3:35.106 slice_and_dice Fluffy_Pillow 26.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(3)
3:36.110 Waiting 0.600 sec 41.7/135: 31% energy | 1.0/5: 20% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(2)
3:36.710 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(2)
3:37.714 Waiting 2.303 sec 15.9/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(2)
3:40.017 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation
3:41.020 Waiting 1.168 sec 15.1/135: 11% energy | 4.0/5: 80% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation
3:42.188 revealing_strike Fluffy_Pillow 47.4/135: 35% energy | 4.0/5: 80% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation
3:43.194 Waiting 0.885 sec 22.3/135: 16% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation
3:44.079 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation
3:45.083 Waiting 2.363 sec 15.2/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2)
3:47.446 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2)
3:48.450 Waiting 1.378 sec 15.0/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(4)
3:49.828 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(4)
3:50.833 Waiting 0.700 sec 40.2/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice
3:51.533 sinister_strike Fluffy_Pillow 50.6/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice
3:52.536 Waiting 0.700 sec 30.4/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2)
3:53.236 sinister_strike Fluffy_Pillow 55.7/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2)
3:54.240 Waiting 1.999 sec 20.6/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(3)
3:56.239 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(3)
3:57.243 Waiting 1.377 sec 15.0/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(5)
3:58.620 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(5)
3:59.625 Waiting 0.700 sec 40.2/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice
4:00.325 sinister_strike Fluffy_Pillow 65.6/135: 49% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, mark_of_warsong(10)
4:01.330 killing_spree Fluffy_Pillow 31.9/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(10)
4:04.494 sinister_strike Fluffy_Pillow 127.7/135: 95% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(8)
4:05.499 eviscerate Fluffy_Pillow 108.7/135: 81% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(2), mark_of_warsong(8)
4:06.503 sinister_strike Fluffy_Pillow 114.7/135: 85% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
4:07.507 revealing_strike Fluffy_Pillow 95.5/135: 71% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
4:08.512 eviscerate Fluffy_Pillow 86.3/135: 64% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6)
4:09.517 sinister_strike Fluffy_Pillow 92.0/135: 68% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6)
4:10.521 sinister_strike Fluffy_Pillow 72.7/135: 54% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5)
4:11.526 Waiting 0.800 sec 38.2/135: 28% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5)
4:12.326 sinister_strike Fluffy_Pillow 50.6/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4)
4:13.330 Waiting 0.300 sec 31.0/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4)
4:13.630 eviscerate Fluffy_Pillow 35.6/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4)
4:14.635 Waiting 0.600 sec 41.0/135: 30% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3)
4:15.235 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3)
4:16.242 Waiting 2.327 sec 15.5/135: 11% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3)
4:18.569 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong
4:19.573 Waiting 0.400 sec 30.5/135: 23% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_warsong
4:19.973 slice_and_dice Fluffy_Pillow 36.4/135: 27% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_warsong
4:20.977 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 0.0/5: 0% combo_points slice_and_dice
4:21.981 Waiting 1.797 sec 16.2/135: 12% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice
4:23.778 sinister_strike Fluffy_Pillow 57.7/135: 43% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice
4:24.783 Waiting 0.600 sec 37.6/135: 28% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
4:25.383 sinister_strike Fluffy_Pillow 61.5/135: 46% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong(10)
4:26.386 vanish Fluffy_Pillow 27.8/135: 21% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong(10)
4:26.386 ambush Fluffy_Pillow 27.8/135: 21% energy | 4.0/5: 80% combo_points bandits_guile(3), stealth, vanish, slice_and_dice, mark_of_warsong(10)
4:27.391 Waiting 0.300 sec 46.3/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(9)
4:27.691 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(9)
4:28.695 Waiting 1.375 sec 17.3/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(10)
4:30.070 sinister_strike Fluffy_Pillow 54.5/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(9)
4:31.074 use_item_turbulent_vial_of_toxin Fluffy_Pillow 20.6/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(9)
4:31.074 adrenaline_rush Fluffy_Pillow 20.6/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(9), turbulent_vial_of_toxin
4:31.074 Waiting 0.671 sec 20.6/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(9), turbulent_vial_of_toxin
4:31.745 revealing_strike Fluffy_Pillow 42.2/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(9), turbulent_vial_of_toxin
4:32.550 Waiting 0.300 sec 27.8/135: 21% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(8), turbulent_vial_of_toxin
4:32.850 eviscerate Fluffy_Pillow 37.4/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(8), turbulent_vial_of_toxin
4:33.653 sinister_strike Fluffy_Pillow 53.6/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(10), turbulent_vial_of_toxin
4:34.457 Waiting 0.600 sec 31.2/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(10), turbulent_vial_of_toxin
4:35.057 sinister_strike Fluffy_Pillow 51.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(10), turbulent_vial_of_toxin
4:35.861 Waiting 0.300 sec 29.3/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(9), turbulent_vial_of_toxin
4:36.161 sinister_strike Fluffy_Pillow 54.5/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(9), turbulent_vial_of_toxin
4:36.966 Waiting 0.400 sec 31.6/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(9), turbulent_vial_of_toxin
4:37.366 sinister_strike Fluffy_Pillow 60.2/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(9), turbulent_vial_of_toxin
4:38.171 eviscerate Fluffy_Pillow 38.1/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(8), turbulent_vial_of_toxin
4:38.975 sinister_strike Fluffy_Pillow 56.0/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(8), turbulent_vial_of_toxin
4:39.781 Waiting 0.500 sec 33.6/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(7), turbulent_vial_of_toxin
4:40.281 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(7), turbulent_vial_of_toxin
4:41.085 Waiting 0.700 sec 28.0/135: 21% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(7), turbulent_vial_of_toxin
4:41.785 sinister_strike Fluffy_Pillow 51.6/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(6), turbulent_vial_of_toxin
4:42.589 eviscerate Fluffy_Pillow 43.6/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(6), turbulent_vial_of_toxin
4:43.394 eviscerate Fluffy_Pillow 60.5/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(6), turbulent_vial_of_toxin
4:44.199 sinister_strike Fluffy_Pillow 77.0/135: 57% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(5), turbulent_vial_of_toxin
4:45.004 sinister_strike Fluffy_Pillow 68.6/135: 51% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(5), turbulent_vial_of_toxin
4:45.810 Waiting 0.200 sec 44.8/135: 33% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(4), turbulent_vial_of_toxin
4:46.010 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(4), turbulent_vial_of_toxin
4:46.814 Waiting 1.300 sec 30.4/135: 22% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(4)
4:48.114 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(3)
4:49.118 Waiting 0.200 sec 32.2/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(3)
4:49.318 eviscerate Fluffy_Pillow 35.4/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh(3)
4:50.322 slice_and_dice Fluffy_Pillow 56.1/135: 42% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh(2)
4:51.327 sinister_strike Fluffy_Pillow 61.8/135: 46% energy | 0.0/5: 0% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3), mark_of_warsong_oh(2)
4:52.331 Waiting 0.500 sec 42.2/135: 31% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3), mark_of_warsong_oh
4:52.831 revealing_strike Fluffy_Pillow 49.9/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3), mark_of_warsong_oh
4:53.835 killing_spree Fluffy_Pillow 25.1/135: 19% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(2)
4:57.042 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_warsong
4:58.047 sinister_strike Fluffy_Pillow 99.9/135: 74% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice
4:59.053 sinister_strike Fluffy_Pillow 64.8/135: 48% energy | 4.0/5: 80% combo_points bandits_guile(2), slice_and_dice
5:00.057 Waiting 0.400 sec 29.6/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation
5:00.457 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, mark_of_warsong(10)
5:01.463 Waiting 0.493 sec 17.0/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(10)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1262 1202 1202
Agility 3945 3495 3393 (1179)
Stamina 4004 3640 3640
Intellect 746 711 711
Spirit 533 533 533
Health 240240 218400 0
Energy 135 135 0
Combo Points 5 5 0
Crit 24.14% 19.14% 455
Haste 17.34% 10.70% 960
Multistrike 8.82% 3.82% 252
Damage / Heal Versatility 6.65% 3.65% 474
Attack Power 6075 4893 0
Mastery 36.48% 26.48% 576
Armor 841 841 841

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Ralana"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/114/47730546-avatar.jpg"
level=100
race=night_elf
role=attack
position=back
professions=engineering=659/jewelcrafting=659
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cZ!2221020
glyphs=energy/feint/disappearance/poisons/safe_fall/decoy
spec=combat

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=frosty_stew
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/marked_for_death
actions.precombat+=/slice_and_dice,if=talent.marked_for_death.enabled

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
actions+=/kick
actions+=/preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
actions+=/use_item,slot=trinket1
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=energy<60
actions+=/blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
actions+=/shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
actions+=/ambush
actions+=/vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
actions+=/call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
actions+=/call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
actions+=/marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
actions+=/call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
actions+=/call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))

actions.adrenaline_rush=adrenaline_rush,if=time_to_die>=44
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5

actions.killing_spree=killing_spree,if=time_to_die>=44
actions.killing_spree+=/killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5

# Combo point generators

actions.generator=revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
actions.generator+=/sinister_strike,if=dot.revealing_strike.ticking

# Combo point finishers

actions.finisher=death_from_above
actions.finisher+=/eviscerate

head=nightvision_mechshades,id=109171,bonus_id=179/525/531
neck=shifting_taladite_pendant,id=115800,bonus_id=204/525/540,enchant=40haste
shoulders=spaulders_of_burning_focus,id=109934,bonus_id=524
back=barkwound_woodcloak,id=114482,bonus_id=214,enchant=100haste
chest=bloodfeather_chestwrap,id=109885,bonus_id=524
shirt=precious_ribbon,id=52019
tabard=stormwind_tabard,id=118365
wrists=spireflame_bracers,id=114433,bonus_id=132
hands=treacherous_palms,id=113832,bonus_id=43/566
waist=bloodfeather_girdle,id=109830,bonus_id=524
legs=leafmender_legwraps,id=109812,bonus_id=524
feet=blackwater_boots,id=109799,bonus_id=40/499/523/524,gems=35haste
finger1=signet_of_radiant_leaves,id=109762,bonus_id=499/523/524,gems=35haste,enchant=30haste
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50haste
trinket1=turbulent_vial_of_toxin,id=114488,bonus_id=560
trinket2=voidtouched_totem,id=114891
main_hand=the_bladefist,id=113591,bonus_id=566,enchant=mark_of_warsong
off_hand=the_bladefist,id=113591,bonus_id=41/566,enchant=mark_of_warsong

# Gear Summary
# gear_agility=2041
# gear_stamina=2750
# gear_crit_rating=455
# gear_haste_rating=914
# gear_mastery_rating=576
# gear_armor=841
# gear_multistrike_rating=252
# gear_versatility_rating=474
# gear_leech_rating=59
# gear_avoidance_rating=76

Mîrai

Mîrai : 25746 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
25746.3 25746.3 9.4 / 0.037% 2914.1 / 11.3% 1173.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
20.8 20.8 Energy 40.93% 40.7 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced
Talents
  • 15: Subterfuge
  • 30: Nerve Strike
  • 45: Cheat Death
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Shadow Reflection
  • Talent Calculator
Glyphs
  • Glyph of Hemorrhaging Veins
  • Glyph of Cloak of Shadows
  • Glyph of Energy
  • Glyph of Poisons
  • Glyph of Safe Fall
Professions
  • leatherworking: 700
  • jewelcrafting: 700

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:73999|39379|27966|12333|10098|4925|2422&chds=0,147999&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++73999++rupture,C79C6E,0,0,15|t++39379++eviscerate,C79C6E,1,0,15|t++27966++ambush,C79C6E,2,0,15|t++12333++garrote,C79C6E,3,0,15|t++10098++backstab,C79C6E,4,0,15|t++4925++auto_attack_mh,C79C6E,5,0,15|t++2422++auto_attack_oh,C79C6E,6,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,19,17,12,12,10,4,4,3,2,2,1,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|eviscerate|rupture|ambush|backstab|auto_attack_oh|deadly_poison_instant|deadly_poison_dot|shattered_bleed|shadow_reflection: ambush|shadow_reflection: rupture|shadow_reflection: eviscerate|garrote|shadow_reflection: backstab&
http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fhlqtwz358774521zyvtppmihfecbZYYZXYYYZZaZaZZYYXWWWWVWXWXWVUUVUUVVWWWWWXYXWWVWVUUTTTSSQQQQPPOOOOPOOOOOOOOOOOOPOPPQRTUWYYaceiklnopqrrsrqonmllkjifedbbaZZYYYYXXXWVUTSSRQQPPOOONOPQQQRRSTTUVWWXXXXYYYXWWVUUTTTSRQPPPOOOOOOOOOOOPPPPPPPPPPQQRRSSSTUUUVWXYYZabcdeegghhhijjjjjiihgfedcbZYXWVUSRRQQPPPPPPPPPPPPPQQQQQQQRRRSSSSTTTUUUVVVVVVVVVUUUUUUUUUUVUUUUUUUUUUUUUUUUUUUUUUUUUUUTSRQPONMLKI&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.415049,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=25746|max=62032&chxp=1,1,42,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,12,15,25,38,96,118,192,308,354,498,606,750,820,1053,1115,1188,1299,1330,1291,1299,1292,1235,1170,1093,1081,967,876,793,778,639,585,458,390,302,260,183,165,98,74,54,32,25,19,11,5,4,0,1&chds=0,1330&chbh=5&chxt=x&chxl=0:|min=23390|avg=25746|max=28630&chxp=0,1,45,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:27.8,11.6,10.8,5.5,2.6,0.4,0.3,40.9&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=backstab 83.6s|eviscerate 34.9s|ambush 32.5s|rupture 16.6s|slice_and_dice 7.9s|preparation 1.2s|garrote 1.0s|waiting 123.2s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% M-Count M-Hit M-Crit M-Crit% Up%
Mîrai 25746
ambush 3030 11.7% 32.3 9.11sec 28091 27966 Direct 32.3 18992 40830 24920 27.1% 0.0% 12.6 6245 13305 27.1%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.32 32.32 0.00 0.00 1.0045 0.0000 907855.48 981640.26 7.52 27965.85 27965.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.40 27.09% 13305.33 8498 18233 12894.64 0 18233 45289 45289 0.00
multistrike 9.16 72.91% 6244.96 4165 8938 6253.94 0 8938 57205 57205 0.00
hit 23.55 72.86% 18992.26 9035 29792 19018.02 15819 22591 447194 490191 8.78
crit 8.77 27.14% 40829.82 18431 60777 40943.34 0 60777 358168 388956 7.96
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 4901 19.0% 319.4 0.94sec 4607 4925 Direct 319.4 3756 8167 4148 25.1% 19.0% 100.3 1133 2449 25.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 319.41 319.41 0.00 0.00 0.9355 0.0000 1471557.42 1736563.34 15.26 4924.83 4924.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 25.13 25.06% 2449.39 1335 4414 2453.47 1766 3319 61554 71713 14.22
multistrike 75.16 74.94% 1132.81 654 2164 1134.18 962 1345 85145 101502 16.11
hit 178.71 55.95% 3756.22 2181 7213 3760.34 3418 4127 671259 801985 16.28
crit 80.03 25.06% 8167.06 4449 14715 8181.18 7099 9552 653600 761364 14.14
miss 60.67 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2409 9.4% 316.9 0.95sec 2283 2422 Direct 316.9 1860 4049 2055 25.0% 19.0% 99.7 561 1214 25.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 316.87 316.87 0.00 0.00 0.9427 0.0000 723378.74 856078.22 15.50 2421.65 2421.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.98 25.05% 1214.07 663 2198 1215.94 867 1688 30333 35440 14.47
multistrike 74.74 74.95% 561.22 325 1078 561.88 472 662 41948 50154 16.36
hit 177.34 55.97% 1860.49 1084 3592 1862.54 1715 2038 329942 395372 16.53
crit 79.32 25.03% 4049.11 2211 7327 4056.37 3394 4731 321156 375112 14.37
miss 60.22 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
backstab 2807 10.9% 83.2 3.44sec 10143 10098 Direct 83.2 7121 15252 9088 24.2% 0.0% 32.3 2135 4568 24.2%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.21 83.21 0.00 0.00 1.0045 0.0000 844058.76 1048694.97 19.51 10097.97 10097.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.80 24.18% 4568.18 2758 7908 4572.67 0 7908 35631 43672 18.68
multistrike 24.46 75.82% 2135.43 1352 3877 2136.89 1623 3001 52226 65534 20.35
hit 63.09 75.81% 7120.91 4507 12922 7125.49 6334 7995 449231 563584 20.27
crit 20.13 24.19% 15252.08 9194 26362 15280.47 11033 20724 306971 375905 18.35
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
deadly_poison_dot 892 3.5% 199.8 1.50sec 1343 0 Periodic 99.5 1890 4001 2415 24.9% 0.0% 38.6 567 1200 24.9% 99.2%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.76 199.76 99.47 99.47 0.0000 3.0000 268232.99 268232.99 0.00 898.88 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.6 24.86% 1200.02 859 1955 1201.69 0 1785 11519 11519 0.00
multistrike 29.0 75.14% 566.91 421 959 567.38 501 680 16449 16449 0.00
hit 74.7 75.09% 1889.55 46 3195 1890.96 1768 2018 141125 141125 0.00
crit 24.8 24.91% 4000.51 236 6518 4006.33 3397 4875 99140 99140 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance of poisoning the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250140
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deadly_poison_instant 930 3.6% 198.8 1.51sec 1406 0 Direct 198.8 982 2088 1259 25.0% 0.0% 77.1 295 626 25.1%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.76 198.76 0.00 0.00 0.0000 0.0000 279402.00 279402.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.36 25.10% 626.12 442 1006 626.96 510 812 12121 12121 0.00
multistrike 57.78 74.90% 294.77 217 493 295.07 263 349 17033 17033 0.00
hit 149.01 74.97% 982.37 722 1644 983.24 920 1057 146387 146387 0.00
crit 49.75 25.03% 2087.72 1473 3354 2090.31 1842 2442 103860 103860 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
eviscerate 4584 17.8% 34.8 8.51sec 39555 39379 Direct 34.8 27321 59360 35421 25.3% 0.0% 13.5 8197 17856 25.3%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.79 34.79 0.00 0.00 1.0045 0.0000 1376177.85 1559709.09 11.77 39379.00 39379.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.42 25.27% 17855.53 10833 31588 17250.47 0 31588 61003 68333 11.14
multistrike 10.11 74.73% 8196.54 5310 15484 8201.41 0 15484 82832 94626 12.64
hit 26.00 74.72% 27321.45 17701 51614 27337.24 21090 33549 710238 811271 12.47
crit 8.80 25.28% 59359.99 36110 105292 59551.80 36110 105292 522104 585479 10.98
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
garrote 42 0.2% 1.0 0.00sec 12387 12333 Periodic 9.0 910 1865 1232 33.7% 0.0% 3.5 273 559 34.0% 6.0%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 9.00 9.00 1.0045 2.0000 12382.59 12382.59 0.00 651.82 12333.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.2 33.96% 559.12 468 611 394.96 0 611 666 666 0.00
multistrike 2.3 66.04% 273.10 229 299 249.88 0 299 632 632 0.00
hit 6.0 66.31% 910.41 764 998 909.93 0 998 5431 5431 0.00
crit 3.0 33.69% 1865.22 1559 2035 1817.19 0 2035 5654 5654 0.00
 
DPS Timeline Chart
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&time<1
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for {$1330d=3 seconds} and causing $o1 damage over {$d=18 seconds}. Awards {$s3=1} combo $lpoint:points;{$?s138106=false}[ and causes you to appear behind the target][].{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.078000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
rupture 4094 15.9% 16.6 18.52sec 74331 73999 Periodic 190.6 4529 9584 5786 24.9% 0.0% 74.0 1359 2876 24.9% 126.6%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.56 16.56 190.56 190.56 1.0045 2.0000 1230904.90 1230904.90 0.00 3094.67 73999.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.4 24.89% 2876.43 2471 4687 2879.47 2471 3702 52951 52951 0.00
multistrike 55.5 75.11% 1358.50 1211 2298 1359.55 1231 1558 75463 75463 0.00
hit 143.2 75.14% 4529.17 4037 7659 4532.42 4297 4823 648543 648543 0.00
crit 47.4 24.86% 9583.91 8235 15625 9595.84 8513 10992 453948 453948 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 744 2.9% 34.3 9.20sec 6526 0 Direct 34.3 1639 3347 2065 25.0% 0.0% 13.3 492 1004 24.9%  
Periodic 166.0 779 0 779 0.0% 0.0% 64.3 238 0 0.0% 55.2%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.27 34.27 166.04 166.04 0.0000 1.0000 223656.28 223656.28 0.00 1347.01 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.31 24.89% 1004.25 972 1118 965.45 0 1118 3328 3328 0.00
multistrike 10.00 75.11% 491.55 477 548 491.64 0 548 4915 4915 0.00
hit 25.72 75.04% 1638.50 1589 1827 1639.03 1589 1732 42143 42143 0.00
crit 8.55 24.96% 3347.18 3241 3727 3347.04 0 3727 28629 28629 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 64.3 100.00% 238.33 238 238 238.33 238 238 15333 15333 0.00
hit 166.0 100.00% 778.78 1 794 778.82 755 793 129308 129308 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - shadow_reflection 8793 / 1313
ambush 4071 2.4% 10.3 24.72sec 17655 0 Direct 10.3 11876 24061 15809 32.3% 0.0% 4.0 3563 7213 32.4%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.32 10.32 0.00 0.00 0.0000 0.0000 182188.29 279994.63 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.30 32.42% 7212.51 6278 7471 5311.44 0 7471 9382 14418 25.68
multistrike 2.71 67.58% 3562.52 3139 3735 3351.74 0 3735 9660 14846 32.79
hit 6.99 67.72% 11876.09 10464 12451 11912.58 10464 12451 82993 127548 34.93
crit 3.33 32.28% 24060.53 20927 24902 23642.92 0 24902 80153 123182 34.24
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
backstab 15 0.0% 0.1 84.05sec 8625 0 Direct 0.1 5740 11722 7756 33.7% 0.0% 0.0 1721 3476 29.2%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.08 0.08 0.00 0.00 0.0000 0.0000 693.09 1065.17 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.01 29.16% 3476.14 3132 3727 30.81 0 3727 32 49 0.31
multistrike 0.02 70.84% 1721.04 1566 1863 35.51 0 1863 38 59 0.72
hit 0.05 66.30% 5739.88 5220 6211 299.85 0 6211 306 470 1.82
crit 0.03 33.70% 11721.99 10440 12422 314.35 0 12422 317 488 0.94
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
eviscerate 2167 1.3% 2.7 107.30sec 35955 0 Direct 2.7 24291 49399 32184 31.4% 0.0% 1.1 7288 14811 31.6%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.70 2.70 0.00 0.00 0.0000 0.0000 97018.85 149102.65 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.33 31.59% 14811.20 12885 15332 4252.39 0 15332 4926 7570 10.02
multistrike 0.72 68.41% 7287.64 6442 7666 3782.88 0 7666 5248 8066 18.08
hit 1.85 68.56% 24291.24 21474 25553 22419.85 0 25553 44939 69063 32.04
crit 0.85 31.44% 49398.80 42949 51106 30990.85 0 51106 41906 64404 21.84
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.577000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
rupture 2540 1.5% 1.8 162.03sec 62778 0 Periodic 21.0 3754 7903 4830 25.9% 0.0% 8.1 1126 2373 26.0% 14.0%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.81 1.81 21.02 21.02 0.0000 2.0000 113344.37 113344.37 0.00 2695.72 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.1 25.96% 2372.91 1865 3077 2031.01 0 3077 5012 5012 0.00
multistrike 6.0 74.04% 1125.78 933 1539 1117.59 0 1539 6784 6784 0.00
hit 15.6 74.05% 3753.57 3108 5128 3765.19 0 4965 58438 58438 0.00
crit 5.5 25.95% 7903.14 6217 10257 7898.53 0 10257 43110 43110 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Mîrai
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
premeditation 8.5 38.48sec

Stats details: premeditation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.53 8.53 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: premeditation

Static Values
  • id:14183
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
Spelldata
  • id:14183
  • name:Premeditation
  • school:physical
  • tooltip:
  • description:Adds {$s1=2} combo points. You must add to or use those combo points within {$d=18 seconds} or the combo points are lost.
 
preparation 1.2 312.69sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.17 1.17 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
shadow_dance 5.3 61.88sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.30 5.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 5.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_dance

Static Values
  • id:51713
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
Spelldata
  • id:51713
  • name:Shadow Dance
  • school:physical
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
 
shadow_reflection 2.9 124.25sec

Stats details: shadow_reflection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 2.88 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 2.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_reflection

Static Values
  • id:152151
  • school:physical
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shadow_dance.up
Spelldata
  • id:152151
  • name:Shadow Reflection
  • school:physical
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
 
slice_and_dice 8.8 35.84sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.82 8.82 0.00 0.00 0.8907 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 4.2 71.91sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.21 4.21 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 4.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
anticipation 34.5 40.5 8.8sec 4.0sec 34.43% 34.44% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:12.60%
  • anticipation_2:5.60%
  • anticipation_3:5.65%
  • anticipation_4:6.48%
  • anticipation_5:4.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 28.35% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 123.4sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lucky_flip 2.9 0.0 124.3sec 124.3sec 18.60% 18.62% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_lucky_flip
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1467.00

Stack Uptimes

  • lucky_flip_1:18.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177597
  • name:"Lucky" Flip
  • tooltip:Increases Agility by {$s1=870}.
  • description:Increases your Agility by {$s1=870} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.1 0.0 61.0sec 61.0sec 10.19% 10.21% 5.0(5.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:10.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31666
  • name:Master of Subtlety
  • tooltip:
  • description:
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
master_of_subtlety_passive (_passive) 5.2 0.0 61.2sec 71.9sec 5.19% 5.20% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety_passive
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • master_of_subtlety_passive_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for 6 seconds after breaking stealth cause an additional {$s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_dance 5.3 0.0 61.9sec 61.9sec 17.35% 17.36% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_dance_1:17.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51713
  • name:Shadow Dance
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
shadow_reflection 2.9 0.0 124.3sec 124.3sec 14.99% 15.00% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_reflection
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_reflection_1:14.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:152151
  • name:Shadow Reflection
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
  • max_stacks:0
  • duration:16.00
  • cooldown:120.00
  • default_chance:100.00%
slice_and_dice 2.2 6.6 132.4sec 35.8sec 99.73% 100.00% 156.2(156.2)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.71% 19.72% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 5.2 0.0 61.2sec 71.9sec 5.19% 5.20% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stealth_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
subterfuge 5.2 0.0 61.2sec 71.9sec 5.19% 5.20% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • subterfuge_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:Your Stealth breaks {$d=3 seconds} after dealing or receiving damage, rather than immediately.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
vanish 4.2 0.0 71.9sec 71.9sec 4.17% 4.19% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vanish_1:4.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mîrai
ambush Energy 32.3 1470.6 45.5 45.5 617.3
backstab Energy 83.2 2912.4 35.0 35.0 289.8
eviscerate Energy 34.8 1217.7 35.0 35.0 1130.2
eviscerate Combo Points 34.8 174.0 5.0 5.0 7911.1
garrote Energy 1.0 45.0 45.0 45.0 275.3
rupture Energy 16.6 414.0 25.0 25.0 2973.3
rupture Combo Points 16.6 82.8 5.0 5.0 14866.3
slice_and_dice Energy 8.8 195.6 22.2 22.2 0.0
slice_and_dice Combo Points 8.8 44.1 5.0 5.0 0.0
Resource Gains Type Count Total Average Overflow
garrote Combo Points 1.00 1.00 (0.33%) 1.00 0.00 0.00%
ambush Combo Points 37.06 64.59 (21.51%) 1.74 0.00 0.00%
backstab Combo Points 83.21 83.21 (27.71%) 1.00 0.00 0.00%
energy_regen Energy 815.91 3483.75 (56.56%) 4.27 0.00 0.00%
external_healing Health 8.74 0.00 (0.00%) 0.00 81316.65 100.00%
energetic_recovery Energy 149.57 1196.57 (19.43%) 8.00 0.00 0.00%
honor_among_thieves Combo Points 135.65 135.65 (45.17%) 1.00 0.00 0.00%
premeditation Combo Points 8.49 15.87 (5.28%) 1.87 0.00 0.00%
relentless_strikes Energy 60.17 1479.36 (24.02%) 24.58 25.00 1.66%
Resource RPS-Gain RPS-Loss
Energy 20.47 20.78
Combo Points 1.00 1.00
Combat End Resource Mean Min Max
Energy 24.72 0.01 97.20
Combo Points 3.58 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%
shadow_reflection-Energy Cap 0.0%

Procs

Count Interval
Anticipation Charges (wasted) 0.7 88.5sec
Honor Among Thieves (Proxy action) 136.3 2.2sec

Statistics & Data Analysis

Fight Length
Sample Data Mîrai Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Mîrai Damage Per Second
Count 25000
Mean 25746.27
Minimum 23389.80
Maximum 28629.87
Spread ( max - min ) 5240.08
Range [ ( max - min ) / 2 * 100% ] 10.18%
Standard Deviation 760.6273
5th Percentile 24566.20
95th Percentile 27053.55
( 95th Percentile - 5th Percentile ) 2487.35
Mean Distribution
Standard Deviation 4.8106
95.00% Confidence Intervall ( 25736.84 - 25755.70 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3352
0.1 Scale Factor Error with Delta=300 4938
0.05 Scale Factor Error with Delta=300 19755
0.01 Scale Factor Error with Delta=300 493886
Distribution Chart
DPS(e)
Sample Data Mîrai Damage Per Second (Effective)
Count 25000
Mean 25746.27
Minimum 23389.80
Maximum 28629.87
Spread ( max - min ) 5240.08
Range [ ( max - min ) / 2 * 100% ] 10.18%
Damage
Sample Data Mîrai Damage
Count 25000
Mean 7337607.01
Minimum 5391018.08
Maximum 9202508.71
Spread ( max - min ) 3811490.63
Range [ ( max - min ) / 2 * 100% ] 25.97%
DTPS
Sample Data Mîrai Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mîrai Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Mîrai Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mîrai Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mîrai Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mîrai Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data MîraiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Mîrai Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=calamari_crepes
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 slice_and_dice
7 0.00 honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1
Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
9 0.00 kick
A 2.88 use_item,slot=trinket2,if=buff.shadow_dance.up
B 2.88 shadow_reflection,if=buff.shadow_dance.up
C 0.00 blood_fury,if=buff.shadow_dance.up
D 0.00 berserking,if=buff.shadow_dance.up
E 0.00 arcane_torrent,if=energy<60&buff.shadow_dance.up
F 0.00 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
G 8.53 premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
H 0.00 pool_resource,for_next=1
I 1.00 garrote,if=!ticking&time<1
J 2.49 wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
K 0.00 pool_resource,for_next=1
L 32.32 ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
M 0.00 pool_resource,for_next=1,extra_amount=50
N 5.30 shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
O 0.00 pool_resource,for_next=1,extra_amount=50
P 0.00 vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
Q 0.00 pool_resource,for_next=1,extra_amount=90
R 4.21 vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
S 0.00 marked_for_death,if=combo_points=0
T 0.00 run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
U 0.00 run_action_list,name=finisher,if=combo_points=5
V 0.00 run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
W 0.00 run_action_list,name=pool
actions.generator Combo point generators
# count action,conditions
X 0.00 run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
Y 0.00 fan_of_knives,if=active_enemies>1
Z 0.00 shuriken_toss,if=energy<65&energy.regen<16
a 83.21 backstab
b 0.00 hemorrhage,if=position_front
c 0.00 run_action_list,name=pool
actions.finisher Combo point finishers
# count action,conditions
d 16.56 rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
e 7.82 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
f 0.00 death_from_above
g 0.00 crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
h 34.79 eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
i 0.00 run_action_list,name=pool
actions.pool Resource pooling
# count action,conditions
j 1.17 preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

Sample Sequence

0124567GILNABLdLLhLLhhaaadaahRGLLjeaaadhaahRLJGLhahaaadNLLeLGhLLhhaadaaahaahaaaadaaaeaaadhaahNABGL8LhLLdhaaaaeRGLhLhadaaahaahaaeaadaaNLLhLhGLdahaahaaaeaaadaahaahaadaahRGLJLeaaadhNABLLLhLhahaadaahaaaeaaadaahaaha

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre slice_and_dice Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
Pre honor_among_thieves Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 premeditation Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/5: 40% combo_points slice_and_dice, draenic_agility_potion
0:01.004 ambush Fluffy_Pillow 89.5/120: 75% energy | 3.0/5: 60% combo_points bloodlust, subterfuge, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion
0:02.009 shadow_dance Fluffy_Pillow 52.1/120: 43% energy | 5.0/5: 100% combo_points bloodlust, subterfuge, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion
0:02.009 use_item_lucky_doublesided_coin Fluffy_Pillow 52.1/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion
0:02.009 shadow_reflection Fluffy_Pillow 52.1/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:02.009 ambush Fluffy_Pillow 52.1/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:03.014 rupture Fluffy_Pillow 26.6/120: 22% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:04.019 ambush Fluffy_Pillow 49.2/120: 41% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:06.045 ambush Fluffy_Pillow 46.5/120: 39% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:07.049 Waiting 0.973 sec 21.0/120: 18% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:08.022 eviscerate Fluffy_Pillow 43.1/120: 36% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:09.025 ambush Fluffy_Pillow 47.6/120: 40% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:10.796 ambush Fluffy_Pillow 41.3/120: 34% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, anticipation(2), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:11.799 Waiting 0.835 sec 15.8/120: 13% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, anticipation(5), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:12.634 eviscerate Fluffy_Pillow 35.9/120: 30% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, anticipation(5), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:13.638 eviscerate Fluffy_Pillow 40.4/120: 34% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:14.642 backstab Fluffy_Pillow 53.0/120: 44% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:15.646 Waiting 0.200 sec 32.5/120: 27% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:15.846 backstab Fluffy_Pillow 35.4/120: 29% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:16.850 Waiting 0.843 sec 22.9/120: 19% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:17.693 backstab Fluffy_Pillow 35.1/120: 29% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:18.698 Waiting 0.361 sec 22.7/120: 19% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, anticipation, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:19.059 rupture Fluffy_Pillow 27.9/120: 23% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, anticipation, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:20.066 backstab Fluffy_Pillow 50.5/120: 42% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, lucky_flip
0:22.095 Waiting 0.500 sec 52.8/120: 44% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice
0:22.595 backstab Fluffy_Pillow 60.1/120: 50% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice
0:23.600 eviscerate Fluffy_Pillow 39.6/120: 33% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice
0:26.903 vanish Fluffy_Pillow 93.4/120: 78% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice
0:26.903 premeditation Fluffy_Pillow 93.4/120: 78% energy | 2.0/5: 40% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:26.903 ambush Fluffy_Pillow 93.4/120: 78% energy | 4.0/5: 80% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:28.421 ambush Fluffy_Pillow 63.4/120: 53% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation
0:29.426 Waiting 0.485 sec 18.0/120: 15% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(4)
0:29.911 preparation Fluffy_Pillow 25.0/120: 21% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4)
0:30.916 slice_and_dice Fluffy_Pillow 47.5/120: 40% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:31.921 backstab Fluffy_Pillow 62.1/120: 52% energy | 0.0/5: 0% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:32.926 backstab Fluffy_Pillow 49.6/120: 41% energy | 1.0/5: 20% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:33.929 Waiting 0.100 sec 29.2/120: 24% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:34.029 backstab Fluffy_Pillow 38.6/120: 32% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:35.034 Waiting 0.573 sec 18.1/120: 15% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:35.607 rupture Fluffy_Pillow 26.4/120: 22% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:36.611 eviscerate Fluffy_Pillow 49.0/120: 41% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice
0:37.615 backstab Fluffy_Pillow 53.5/120: 45% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice
0:41.687 backstab Fluffy_Pillow 90.9/120: 76% energy | 4.0/5: 80% combo_points slice_and_dice
0:42.692 eviscerate Fluffy_Pillow 75.1/120: 63% energy | 5.0/5: 100% combo_points slice_and_dice
0:44.461 vanish Fluffy_Pillow 92.8/120: 77% energy | 1.0/5: 20% combo_points slice_and_dice
0:44.461 ambush Fluffy_Pillow 92.8/120: 77% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:46.231 wait Fluffy_Pillow 60.5/120: 50% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:47.231 premeditation Fluffy_Pillow 71.6/120: 60% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:47.231 ambush Fluffy_Pillow 71.6/120: 60% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:48.236 Waiting 0.400 sec 30.8/120: 26% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(2)
0:48.636 eviscerate Fluffy_Pillow 35.3/120: 29% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(3)
0:49.641 backstab Fluffy_Pillow 36.5/120: 30% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice
0:50.647 Waiting 1.289 sec 20.7/120: 17% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:51.936 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:52.940 backstab Fluffy_Pillow 44.2/120: 37% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice
0:53.946 Waiting 0.613 sec 20.4/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
0:54.559 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
0:55.565 Waiting 1.419 sec 11.4/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice
0:56.984 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
0:57.990 Waiting 1.218 sec 11.4/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
0:59.208 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
1:00.213 Waiting 1.800 sec 52.2/120: 43% energy | 2.0/5: 40% combo_points slice_and_dice
1:02.013 shadow_dance Fluffy_Pillow 80.2/120: 67% energy | 3.0/5: 60% combo_points slice_and_dice
1:02.013 ambush Fluffy_Pillow 80.2/120: 67% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice
1:03.017 ambush Fluffy_Pillow 51.4/120: 43% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice
1:04.023 slice_and_dice Fluffy_Pillow 30.6/120: 26% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:05.028 ambush Fluffy_Pillow 41.8/120: 35% energy | 0.0/5: 0% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:07.313 premeditation Fluffy_Pillow 35.2/120: 29% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:07.313 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
1:08.318 ambush Fluffy_Pillow 44.4/120: 37% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice
1:10.857 ambush Fluffy_Pillow 40.7/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2)
1:11.862 Waiting 1.376 sec 11.9/120: 10% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4)
1:13.238 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:14.243 eviscerate Fluffy_Pillow 44.4/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice
1:15.247 backstab Fluffy_Pillow 45.6/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice
1:16.253 Waiting 0.500 sec 29.8/120: 25% energy | 2.0/5: 40% combo_points slice_and_dice
1:16.753 backstab Fluffy_Pillow 35.4/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
1:17.759 Waiting 1.307 sec 11.6/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice
1:19.066 rupture Fluffy_Pillow 34.1/120: 28% energy | 5.0/5: 100% combo_points slice_and_dice
1:20.070 backstab Fluffy_Pillow 53.3/120: 44% energy | 0.0/5: 0% combo_points slice_and_dice
1:21.073 Waiting 0.500 sec 29.5/120: 25% energy | 1.0/5: 20% combo_points slice_and_dice
1:21.573 backstab Fluffy_Pillow 35.0/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
1:22.577 Waiting 1.420 sec 19.2/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice
1:23.997 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
1:25.001 Waiting 1.020 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
1:26.021 eviscerate Fluffy_Pillow 38.6/120: 32% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:27.025 backstab Fluffy_Pillow 39.7/120: 33% energy | 1.0/5: 20% combo_points slice_and_dice
1:28.027 Waiting 1.000 sec 23.9/120: 20% energy | 3.0/5: 60% combo_points slice_and_dice
1:29.027 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
1:30.031 Waiting 1.419 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
1:31.450 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
1:32.456 backstab Fluffy_Pillow 44.2/120: 37% energy | 1.0/5: 20% combo_points slice_and_dice
1:33.461 Waiting 0.612 sec 20.4/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
1:34.073 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
1:35.078 Waiting 1.420 sec 11.4/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice
1:36.498 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
1:37.502 Waiting 1.421 sec 11.4/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:38.923 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
1:39.927 Waiting 1.220 sec 11.4/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(3)
1:41.147 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
1:42.152 backstab Fluffy_Pillow 52.2/120: 43% energy | 4.0/5: 80% combo_points slice_and_dice
1:43.158 Waiting 0.600 sec 28.4/120: 24% energy | 5.0/5: 100% combo_points slice_and_dice
1:43.758 backstab Fluffy_Pillow 35.1/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:44.763 Waiting 1.315 sec 19.3/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
1:46.078 backstab Fluffy_Pillow 41.9/120: 35% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(3)
1:47.083 Waiting 0.720 sec 18.1/120: 15% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
1:47.803 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:48.808 backstab Fluffy_Pillow 45.3/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation(5)
1:49.811 Waiting 0.517 sec 21.5/120: 18% energy | 1.0/5: 20% combo_points slice_and_dice, anticipation(5)
1:50.328 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(5)
1:51.332 Waiting 1.421 sec 11.4/120: 10% energy | 3.0/5: 60% combo_points slice_and_dice, anticipation(5)
1:52.753 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(5)
1:53.760 Waiting 1.217 sec 11.4/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:54.977 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:55.980 eviscerate Fluffy_Pillow 44.2/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, spirit_of_the_warlords
1:56.984 backstab Fluffy_Pillow 53.3/120: 44% energy | 1.0/5: 20% combo_points slice_and_dice, spirit_of_the_warlords
1:57.990 Waiting 0.100 sec 29.5/120: 25% energy | 2.0/5: 40% combo_points slice_and_dice, spirit_of_the_warlords
1:58.090 backstab Fluffy_Pillow 38.7/120: 32% energy | 2.0/5: 40% combo_points slice_and_dice, spirit_of_the_warlords
1:59.094 Waiting 2.112 sec 14.8/120: 12% energy | 4.0/5: 80% combo_points slice_and_dice, spirit_of_the_warlords
2:01.206 eviscerate Fluffy_Pillow 46.4/120: 39% energy | 5.0/5: 100% combo_points slice_and_dice, spirit_of_the_warlords
2:02.211 shadow_dance Fluffy_Pillow 55.5/120: 46% energy | 0.0/5: 0% combo_points slice_and_dice, spirit_of_the_warlords
2:02.211 use_item_lucky_doublesided_coin Fluffy_Pillow 55.5/120: 46% energy | 0.0/5: 0% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords
2:02.211 shadow_reflection Fluffy_Pillow 55.5/120: 46% energy | 0.0/5: 0% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords, lucky_flip
2:02.211 premeditation Fluffy_Pillow 55.5/120: 46% energy | 0.0/5: 0% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, lucky_flip
2:02.211 ambush Fluffy_Pillow 55.5/120: 46% energy | 2.0/5: 40% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, lucky_flip
2:03.471 potion Fluffy_Pillow 29.6/120: 25% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, lucky_flip
2:04.235 ambush Fluffy_Pillow 46.1/120: 38% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:05.749 Waiting 0.385 sec 22.9/120: 19% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:06.134 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:07.648 ambush Fluffy_Pillow 42.1/120: 35% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:10.190 ambush Fluffy_Pillow 46.4/120: 39% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(2), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:11.193 Waiting 0.768 sec 17.6/120: 15% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:11.961 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:12.967 eviscerate Fluffy_Pillow 45.3/120: 38% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:13.970 backstab Fluffy_Pillow 46.5/120: 39% energy | 0.0/5: 0% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:14.973 Waiting 0.400 sec 30.7/120: 26% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:15.373 backstab Fluffy_Pillow 35.1/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection, draenic_agility_potion, lucky_flip
2:16.377 Waiting 1.413 sec 19.3/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, draenic_agility_potion, lucky_flip
2:17.790 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, shadow_reflection, draenic_agility_potion, lucky_flip
2:18.796 Waiting 1.218 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, draenic_agility_potion, lucky_flip
2:20.014 backstab Fluffy_Pillow 40.8/120: 34% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, draenic_agility_potion, lucky_flip
2:21.018 Waiting 2.121 sec 17.0/120: 14% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(3), draenic_agility_potion, lucky_flip
2:23.139 slice_and_dice Fluffy_Pillow 48.6/120: 40% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4), draenic_agility_potion
2:26.190 vanish Fluffy_Pillow 98.6/120: 82% energy | 1.0/5: 20% combo_points slice_and_dice, anticipation(4), draenic_agility_potion
2:26.190 premeditation Fluffy_Pillow 98.6/120: 82% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, anticipation(4), draenic_agility_potion
2:26.190 ambush Fluffy_Pillow 98.6/120: 82% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, anticipation(4), draenic_agility_potion
2:27.195 eviscerate Fluffy_Pillow 49.7/120: 41% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(4), draenic_agility_potion
2:28.457 ambush Fluffy_Pillow 61.8/120: 51% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, draenic_agility_potion
2:29.462 Waiting 1.278 sec 13.0/120: 11% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(2)
2:30.740 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(3)
2:31.743 backstab Fluffy_Pillow 36.4/120: 30% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice
2:32.748 Waiting 0.496 sec 20.6/120: 17% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
2:33.244 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
2:34.249 backstab Fluffy_Pillow 45.3/120: 38% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice
2:35.254 Waiting 0.815 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice
2:36.069 backstab Fluffy_Pillow 38.6/120: 32% energy | 3.0/5: 60% combo_points slice_and_dice
2:37.073 Waiting 1.121 sec 14.7/120: 12% energy | 4.0/5: 80% combo_points slice_and_dice
2:38.194 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
2:39.198 Waiting 1.421 sec 11.4/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:40.619 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
2:41.621 backstab Fluffy_Pillow 36.4/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice
2:42.626 Waiting 1.297 sec 20.6/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
2:43.923 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
2:44.928 Waiting 1.120 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:46.048 eviscerate Fluffy_Pillow 39.7/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:47.051 backstab Fluffy_Pillow 40.8/120: 34% energy | 1.0/5: 20% combo_points slice_and_dice
2:48.054 Waiting 0.900 sec 25.0/120: 21% energy | 3.0/5: 60% combo_points slice_and_dice
2:48.954 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
2:49.957 Waiting 1.238 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice
2:51.195 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice
2:52.199 backstab Fluffy_Pillow 52.2/120: 43% energy | 1.0/5: 20% combo_points slice_and_dice
2:53.203 Waiting 0.600 sec 28.4/120: 24% energy | 2.0/5: 40% combo_points slice_and_dice
2:53.803 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
2:54.806 Waiting 1.220 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
2:56.026 rupture Fluffy_Pillow 40.8/120: 34% energy | 5.0/5: 100% combo_points slice_and_dice
2:57.030 backstab Fluffy_Pillow 52.0/120: 43% energy | 0.0/5: 0% combo_points slice_and_dice
2:58.037 backstab Fluffy_Pillow 36.2/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice
2:59.043 Waiting 3.233 sec 12.4/120: 10% energy | 3.0/5: 60% combo_points slice_and_dice
3:02.276 shadow_dance Fluffy_Pillow 64.4/120: 54% energy | 5.0/5: 100% combo_points slice_and_dice
3:02.276 ambush Fluffy_Pillow 64.4/120: 54% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice
3:03.789 ambush Fluffy_Pillow 41.2/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2)
3:04.794 Waiting 1.211 sec 20.4/120: 17% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:06.005 eviscerate Fluffy_Pillow 41.9/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(5)
3:07.008 ambush Fluffy_Pillow 43.1/120: 36% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation
3:08.013 Waiting 1.145 sec 22.3/120: 19% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:09.158 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4)
3:10.163 premeditation Fluffy_Pillow 44.2/120: 37% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice
3:10.163 ambush Fluffy_Pillow 44.2/120: 37% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice
3:11.167 Waiting 0.863 sec 15.4/120: 13% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:12.030 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:13.035 backstab Fluffy_Pillow 44.2/120: 37% energy | 3.0/5: 60% combo_points slice_and_dice
3:14.041 Waiting 0.600 sec 28.4/120: 24% energy | 5.0/5: 100% combo_points slice_and_dice
3:14.641 eviscerate Fluffy_Pillow 35.1/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
3:15.645 backstab Fluffy_Pillow 36.2/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice
3:16.649 Waiting 1.310 sec 20.4/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
3:17.959 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
3:18.964 Waiting 1.120 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
3:20.084 eviscerate Fluffy_Pillow 39.7/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice
3:21.086 backstab Fluffy_Pillow 40.8/120: 34% energy | 0.0/5: 0% combo_points slice_and_dice
3:22.091 Waiting 0.900 sec 25.0/120: 21% energy | 2.0/5: 40% combo_points slice_and_dice
3:22.991 backstab Fluffy_Pillow 35.0/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
3:23.995 Waiting 1.436 sec 11.2/120: 9% energy | 3.0/5: 60% combo_points slice_and_dice
3:25.431 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
3:26.436 Waiting 0.602 sec 19.4/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:27.038 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:28.042 backstab Fluffy_Pillow 45.3/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation
3:29.048 Waiting 1.014 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
3:30.062 backstab Fluffy_Pillow 40.8/120: 34% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
3:31.066 Waiting 1.021 sec 17.0/120: 14% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
3:32.087 backstab Fluffy_Pillow 36.3/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
3:33.092 Waiting 1.120 sec 12.5/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
3:34.212 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
3:35.216 backstab Fluffy_Pillow 44.2/120: 37% energy | 2.0/5: 40% combo_points slice_and_dice
3:36.222 Waiting 0.600 sec 28.4/120: 24% energy | 4.0/5: 80% combo_points slice_and_dice
3:36.822 backstab Fluffy_Pillow 35.1/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
3:37.825 Waiting 1.436 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:39.261 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:40.265 backstab Fluffy_Pillow 44.4/120: 37% energy | 2.0/5: 40% combo_points slice_and_dice
3:41.268 Waiting 0.798 sec 20.6/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
3:42.066 backstab Fluffy_Pillow 37.5/120: 31% energy | 4.0/5: 80% combo_points slice_and_dice
3:43.069 Waiting 1.221 sec 13.6/120: 11% energy | 5.0/5: 100% combo_points slice_and_dice
3:44.290 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:45.295 backstab Fluffy_Pillow 36.4/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice
3:46.300 Waiting 1.295 sec 20.6/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
3:47.595 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
3:48.600 Waiting 0.619 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
3:49.219 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice
3:50.223 backstab Fluffy_Pillow 45.3/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice
3:51.230 Waiting 0.814 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice
3:52.044 backstab Fluffy_Pillow 38.6/120: 32% energy | 2.0/5: 40% combo_points slice_and_dice
3:53.049 Waiting 2.220 sec 14.8/120: 12% energy | 3.0/5: 60% combo_points slice_and_dice
3:55.269 eviscerate Fluffy_Pillow 47.5/120: 40% energy | 5.0/5: 100% combo_points slice_and_dice, spirit_of_the_warlords
3:58.578 vanish Fluffy_Pillow 90.3/120: 75% energy | 1.0/5: 20% combo_points slice_and_dice, spirit_of_the_warlords
3:58.578 premeditation Fluffy_Pillow 90.3/120: 75% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, spirit_of_the_warlords
3:58.578 ambush Fluffy_Pillow 90.3/120: 75% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, spirit_of_the_warlords
4:00.347 wait Fluffy_Pillow 58.0/120: 48% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation, spirit_of_the_warlords
4:01.347 ambush Fluffy_Pillow 69.2/120: 58% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation, spirit_of_the_warlords
4:02.353 slice_and_dice Fluffy_Pillow 28.4/120: 24% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(4), spirit_of_the_warlords
4:03.356 backstab Fluffy_Pillow 39.5/120: 33% energy | 0.0/5: 0% combo_points master_of_subtlety, slice_and_dice, anticipation(4), spirit_of_the_warlords
4:04.360 Waiting 1.016 sec 23.7/120: 20% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice, anticipation(4), spirit_of_the_warlords
4:05.376 backstab Fluffy_Pillow 35.0/120: 29% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice, anticipation(4), spirit_of_the_warlords
4:06.379 Waiting 1.422 sec 19.2/120: 16% energy | 4.0/5: 80% combo_points master_of_subtlety, slice_and_dice, anticipation(4), spirit_of_the_warlords
4:07.801 backstab Fluffy_Pillow 35.0/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(4), spirit_of_the_warlords
4:08.806 Waiting 0.619 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5), spirit_of_the_warlords
4:09.425 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5), spirit_of_the_warlords
4:10.430 eviscerate Fluffy_Pillow 45.3/120: 38% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, spirit_of_the_warlords
4:11.950 shadow_dance Fluffy_Pillow 52.2/120: 44% energy | 1.0/5: 20% combo_points slice_and_dice, spirit_of_the_warlords
4:11.950 use_item_lucky_doublesided_coin Fluffy_Pillow 52.2/120: 44% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords
4:11.950 shadow_reflection Fluffy_Pillow 52.2/120: 44% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords, lucky_flip
4:11.950 ambush Fluffy_Pillow 52.2/120: 44% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, lucky_flip
4:13.978 ambush Fluffy_Pillow 42.8/120: 36% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, lucky_flip
4:16.005 ambush Fluffy_Pillow 41.4/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(2), lucky_flip
4:17.012 Waiting 1.314 sec 12.6/120: 10% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(5), lucky_flip
4:18.326 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(5), lucky_flip
4:19.839 ambush Fluffy_Pillow 42.1/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation, lucky_flip
4:20.844 Waiting 1.236 sec 21.3/120: 18% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), lucky_flip
4:22.080 eviscerate Fluffy_Pillow 43.0/120: 36% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(4), lucky_flip
4:23.085 backstab Fluffy_Pillow 44.2/120: 37% energy | 4.0/5: 80% combo_points slice_and_dice, shadow_reflection, lucky_flip
4:24.090 Waiting 0.600 sec 28.4/120: 24% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation, lucky_flip
4:24.690 eviscerate Fluffy_Pillow 35.1/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation, lucky_flip
4:25.693 backstab Fluffy_Pillow 36.3/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice, shadow_reflection, lucky_flip
4:26.697 Waiting 1.310 sec 20.4/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, lucky_flip
4:28.007 backstab Fluffy_Pillow 43.0/120: 36% energy | 4.0/5: 80% combo_points slice_and_dice, lucky_flip
4:29.011 Waiting 0.621 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, lucky_flip
4:29.632 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, lucky_flip
4:30.635 backstab Fluffy_Pillow 45.3/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice, lucky_flip
4:31.640 Waiting 0.516 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, lucky_flip
4:32.156 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
4:33.160 Waiting 1.421 sec 11.4/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice
4:34.581 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
4:35.586 backstab Fluffy_Pillow 36.4/120: 30% energy | 0.0/5: 0% combo_points slice_and_dice
4:36.590 Waiting 1.295 sec 20.6/120: 17% energy | 1.0/5: 20% combo_points slice_and_dice
4:37.885 backstab Fluffy_Pillow 35.0/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
4:38.888 Waiting 1.122 sec 19.2/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice
4:40.010 backstab Fluffy_Pillow 39.7/120: 33% energy | 4.0/5: 80% combo_points slice_and_dice
4:41.014 Waiting 0.921 sec 15.9/120: 13% energy | 5.0/5: 100% combo_points slice_and_dice
4:41.935 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:42.939 backstab Fluffy_Pillow 45.3/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation
4:43.944 Waiting 0.516 sec 21.5/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
4:44.460 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
4:45.465 Waiting 1.419 sec 11.4/120: 10% energy | 3.0/5: 60% combo_points slice_and_dice, anticipation
4:46.884 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
4:47.888 Waiting 1.221 sec 11.4/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:49.109 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:50.113 backstab Fluffy_Pillow 52.2/120: 43% energy | 3.0/5: 60% combo_points slice_and_dice
4:51.119 Waiting 0.600 sec 28.4/120: 24% energy | 4.0/5: 80% combo_points slice_and_dice
4:51.719 backstab Fluffy_Pillow 35.1/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
4:52.723 Waiting 1.317 sec 19.2/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:54.040 eviscerate Fluffy_Pillow 41.9/120: 35% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:55.044 backstab Fluffy_Pillow 43.1/120: 36% energy | 2.0/5: 40% combo_points slice_and_dice
4:56.050 Waiting 0.700 sec 27.3/120: 23% energy | 3.0/5: 60% combo_points slice_and_dice
4:56.750 backstab Fluffy_Pillow 35.1/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
4:57.755 Waiting 1.433 sec 11.3/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice
4:59.188 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
5:00.194 backstab Fluffy_Pillow 44.4/120: 37% energy | 1.0/5: 20% combo_points slice_and_dice
5:01.199 Waiting 0.693 sec 20.6/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1271 1211 1211
Agility 4815 4284 3613 (1576)
Stamina 4440 4037 4037
Intellect 745 710 710
Spirit 532 532 532
Health 266400 242220 0
Energy 120 120 0
Combo Points 5 5 0
Crit 25.45% 20.45% 599
Haste 11.35% 6.05% 605
Multistrike 19.39% 12.80% 845
Damage / Heal Versatility 5.92% 2.92% 380
Attack Power 5297 4284 0
Mastery 59.16% 44.16% 739
Armor 938 938 938

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Mîrai"
origin="http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/98/74316130-avatar.jpg"
level=100
race=dwarf
role=attack
position=back
professions=jewelcrafting=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cb!1101021
glyphs=hemorrhaging_veins/cloak_of_shadows/energy/poisons/safe_fall
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/slice_and_dice
# Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
actions.precombat+=/honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
actions+=/kick
actions+=/use_item,slot=trinket2,if=buff.shadow_dance.up
actions+=/shadow_reflection,if=buff.shadow_dance.up
actions+=/blood_fury,if=buff.shadow_dance.up
actions+=/berserking,if=buff.shadow_dance.up
actions+=/arcane_torrent,if=energy<60&buff.shadow_dance.up
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
actions+=/premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
actions+=/pool_resource,for_next=1
actions+=/garrote,if=!ticking&time<1
actions+=/wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
actions+=/pool_resource,for_next=1
actions+=/ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/pool_resource,for_next=1,extra_amount=90
actions+=/vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/marked_for_death,if=combo_points=0
actions+=/run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
actions+=/run_action_list,name=finisher,if=combo_points=5
actions+=/run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
actions+=/run_action_list,name=pool

# Combo point generators

actions.generator=run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
actions.generator+=/fan_of_knives,if=active_enemies>1
actions.generator+=/shuriken_toss,if=energy<65&energy.regen<16
actions.generator+=/backstab
actions.generator+=/hemorrhage,if=position_front
actions.generator+=/run_action_list,name=pool

# Combo point finishers

actions.finisher=rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
actions.finisher+=/death_from_above
actions.finisher+=/crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/run_action_list,name=pool

# Resource pooling

actions.pool=preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

head=runeenscribed_hood,id=113845
neck=shifting_taladite_pendant,id=115800,bonus_id=136/527/539,enchant=75mult
shoulders=studded_frostboar_leather_spaulders,id=118890
back=cloak_of_creeping_necrosis,id=113657,bonus_id=566,enchant=gift_of_multistrike
chest=chestguard_of_determined_resolve,id=114497,bonus_id=52
wrists=railwalker_bindings,id=118955,bonus_id=20
hands=throatripper_gauntlets,id=113602
waist=waistgirdle_of_the_mountain,id=118886
legs=nether_blast_leggings,id=113856
feet=sandals_of_mycoid_musing,id=113664,bonus_id=566
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=30mult
finger2=shifting_taladite_ring,id=115796,bonus_id=181/527/540,enchant=50mult
trinket1=skull_of_war,id=112318,bonus_id=525/529
trinket2=lucky_doublesided_coin,id=118876
main_hand=miniature_winter_veil_tree,id=117371,bonus_id=553,enchant=mark_of_the_shattered_hand
off_hand=felshanker,id=118738,bonus_id=524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_agility=2269
# gear_stamina=3146
# gear_crit_rating=599
# gear_haste_rating=605
# gear_mastery_rating=739
# gear_armor=938
# gear_multistrike_rating=805
# gear_versatility_rating=380

Shaerlyn

Shaerlyn : 27043 dps

Candylicious

Candylicious : 22831 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22830.6 22830.6 7.1 / 0.031% 2220.8 / 9.7% 1.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
14052.2 14052.2 Mana 2.92% 42.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced
Talents
  • 15: Soul Leech
  • 30: Mortal Coil
  • 45: Soul Link
  • 60: Blood Horror
  • 75: Grimoire of Supremacy
  • 90: Kil'jaeden's Cunning
  • 100: Demonic Servitude
  • Talent Calculator
Glyphs
  • Glyph of Siphon Life
  • Glyph of Havoc
  • Glyph of Demon Training
  • Glyph of Nightmares
  • Glyph of Verdant Spheres
Professions
  • inscription: 189
  • tailoring: 700

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Candylicious+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:31128|30821|21121|10416&chds=0,62257&chco=C41F3B,9482C9,C41F3B,C41F3B&chm=t++31128++immolate,C41F3B,0,0,15|t++30821++chaos_bolt,9482C9,1,0,15|t++21121++conflagrate,C41F3B,2,0,15|t++10416++incinerate,C41F3B,3,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:39,36,31,16,11,2&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,9482C9,C41F3B,C41F3B,C79C6E&chl=incinerate|terrorguard: doom_bolt|chaos_bolt|immolate|conflagrate|shattered_bleed&
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Candylicious+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Vcdossuxz477566877644zzqoonnnkhgggfecbbacbabaZbZZYYZZYYYZYabYaZabbZaZYaaZZaabbZaaZaYYaZabcZaaZbaZaaZababaZbaaaaZaaYddgikjkmloqopporsqttoqmlkjhhgeddcedbbbZbZYYYXZZYYZXYYWXXWXXWXXXYXWWYXYZYYZYYaZYZZaaaaababaZbbbcdabcbccbcccddcddcddccdcddbggjlmlnpprrqrrquutvvrtpnmmkjjhhihiheffefdccddeedeecddcddcdcbdccdcbcdcddcdcbddbcecedceddddcdedffdefeffeffeggfggfggfggfgfeeeeeecccaZYVUTRPOM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.531227,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=22831|max=42977&chxp=1,1,53,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Candylicious+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,2,6,12,20,33,66,80,113,188,261,331,421,554,663,828,958,1002,1130,1212,1284,1366,1432,1357,1359,1355,1252,1246,1123,1031,895,789,585,534,397,292,240,204,131,79,58,42,26,19,9,4,3,3,0,3&chds=0,1432&chbh=5&chxt=x&chxl=0:|min=20859|avg=22831|max=25064&chxp=0,1,47,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:62.4,17.0,8.8,8.7,2.9&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C41F3B,C41F3B,ffffff&chl=incinerate 187.7s|chaos_bolt 51.3s|conflagrate 26.5s|immolate 26.1s|waiting 8.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Candylicious 22831
chaos_bolt 5266 23.0% 24.6 12.09sec 64188 30821 Direct 24.4 0 59297 59297 100.0% 7.4 0 17789 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.62 24.43 0.00 0.00 2.0826 0.0000 1580500.24 1580500.24 0.00 30820.99 30820.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.40 100.00% 17789.43 14973 24565 17809.10 0 24565 131698 131698 0.00
crit 24.43 100.00% 59297.23 49910 81885 59375.62 55578 64502 1448802 1448802 0.00
 
DPS Timeline Chart
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.havoc.remains>cast_time&buff.havoc.stack>=3
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:shadow
  • tooltip:Deals Shadow damage every $t2 sec.
  • description:Unleashes a blast of chaos, causing ${$m1*(1+$77220m1/100*$<masteryMod>)} Shadow damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.{$?s116858=true}[][ Replaces Soul Fire.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.107500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
conflagrate 1863 8.2% 26.4 11.57sec 21216 21121 Direct 26.4 14907 30673 19446 28.8% 8.0 4473 9205 28.6%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.37 26.37 0.00 0.00 1.0045 0.0000 559399.16 559399.16 0.00 21121.36 21121.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.29 28.64% 9204.53 8663 10476 8302.28 0 10476 21116 21116 0.00
multistrike 5.72 71.36% 4472.70 4332 5238 4459.93 0 5238 25566 25566 0.00
hit 18.78 71.21% 14906.89 14439 17460 14911.88 14439 15812 279897 279897 0.00
crit 7.59 28.79% 30673.44 28877 34920 30718.28 0 34920 232821 232821 0.00
 
DPS Timeline Chart
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Target enemy instantly explodes, dealing {$s1=2077} Fire damage{$?s56235=false}[, reducing movement speed by {$s2=50}% for {$d=5 seconds},][] and generating Burning Embers.{$?s56235=false}[][ Targets afflicted by Immolate will have {$s2=50}% reduced movement speed for {$d=5 seconds}.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.890000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
immolate 2700 11.8% 20.6 14.91sec 39390 31128 Direct 20.6 7209 14821 9223 26.5% 6.2 2162 4447 26.6%  
Periodic 120.7 3581 7338 4586 26.7% 36.6 1077 2207 26.6% 99.3%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.60 20.60 120.74 120.74 1.2654 2.4755 811333.17 811333.17 0.00 2496.80 31128.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.66 26.61% 4447.28 4202 5081 3631.62 0 5081 7390 7390 0.00
multistrike 4.58 73.39% 2162.37 2101 2540 2142.91 0 2540 9913 9913 0.00
hit 15.15 73.54% 7208.52 7003 8468 7211.21 7003 7735 109188 109188 0.00
crit 5.45 26.46% 14820.75 14006 16936 14831.02 0 16936 80778 80778 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.7 26.58% 2207.16 2100 2540 2208.00 0 2540 21467 21467 0.00
multistrike 26.9 73.42% 1077.17 1050 1270 1077.66 1050 1169 28940 28940 0.00
hit 88.5 73.26% 3581.17 24 4233 3582.74 3443 3684 316782 316782 0.00
crit 32.3 26.74% 7338.43 49 8467 7344.06 6726 7839 236876 236876 0.00
 
DPS Timeline Chart
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy for {$s1=505} Fire damage and an additional $157736o1 Fire damage over {$157736d=15 seconds}.{$?s108647=false}[ Immolate critical strikes generate Burning Embers.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.989820
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.494910
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
incinerate 6502 28.5% 137.2 2.18sec 14247 10416 Direct 136.3 10411 21299 13147 25.1% 41.3 3123 6390 25.1%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.19 136.29 0.00 0.00 1.3678 0.0000 1954543.07 1954543.07 0.00 10415.62 10415.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.36 25.11% 6390.18 6089 7363 6394.30 6089 7363 66233 66233 0.00
multistrike 30.92 74.89% 3123.29 3045 3682 3124.27 3045 3346 96564 96564 0.00
hit 102.05 74.88% 10411.26 10149 12272 10414.48 10192 10658 1062462 1062462 0.00
crit 34.24 25.12% 21299.15 20297 24544 21311.84 20297 22532 729284 729284 0.00
 
DPS Timeline Chart
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:32000.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Deals {$s1=1461} Fire damage to an enemy{$?s108647=false}[ and generates Burning Embers][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.328250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shattered_bleed 401 1.8% 17.9 17.16sec 6749 0 Direct 17.9 1554 3108 1882 21.1% 5.4 466 932 21.1%  
Periodic 100.1 767 0 767 0.0% 30.4 233 0 0.0% 33.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 100.14 100.14 0.0000 1.0000 120531.90 120531.90 0.00 1203.65 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.14 21.13% 932.40 932 932 629.41 0 932 1062 1062 0.00
multistrike 4.25 78.87% 466.20 466 466 459.11 0 466 1982 1982 0.00
hit 14.09 78.91% 1554.00 1554 1554 1554.00 1554 1554 21899 21899 0.00
crit 3.77 21.09% 3108.00 3108 3108 3039.75 0 3108 11705 11705 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 30.4 100.00% 233.10 233 233 233.10 233 233 7083 7083 0.00
hit 100.1 100.00% 766.94 1 777 767.19 738 777 76801 76801 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - terrorguard 6099 / 6099
doom_bolt 6099 26.7% 105.4 2.84sec 17392 7036 Direct 104.7 12502 25545 16040 27.1% 31.7 3750 7664 27.1%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.35 104.71 0.00 0.00 2.4717 0.0000 1832271.95 1832271.95 0.00 7036.35 7036.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.60 27.08% 7664.17 7007 10168 7666.92 0 10168 65890 65890 0.00
multistrike 23.14 72.92% 3749.97 3504 5084 3750.68 3504 4275 86791 86791 0.00
hit 76.31 72.87% 12502.26 11679 16947 12505.36 12011 13006 954003 954003 0.00
crit 28.40 27.13% 25545.02 23357 33893 25565.57 23647 28210 725588 725588 0.00
 
DPS Timeline Chart
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1781} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.{$?s152107=false}[ Master gains {$s3=6} Demonic Fury. |cFF777777(Right-Click to toggle)|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.620000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Candylicious
dark_soul 3.0 120.97sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.39 79.53% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.61 20.47% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: dark_soul

Static Values
  • id:113858
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:8000.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
Spelldata
  • id:113858
  • name:Dark Soul: Instability
  • school:fire
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
summon_terrorguard 1.0 0.00sec

Stats details: summon_terrorguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.63 81.46% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.37 18.54% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_terrorguard

Static Values
  • id:112927
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:20000.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic_servitude.enabled&active_enemies<5
Spelldata
  • id:112927
  • name:Summon Terrorguard
  • school:shadow
  • tooltip:
  • description:Summons a Terrorguard for {$112926d=60 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
backdraft 24.7 1.7 12.3sec 11.6sec 49.37% 49.38% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_backdraft
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • backdraft_1:12.76%
  • backdraft_2:15.73%
  • backdraft_3:19.03%
  • backdraft_4:0.80%
  • backdraft_5:0.40%
  • backdraft_6:0.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate's cast time and mana cost reduced by {$s1=30}%.$?$W3<>0[ Chaos Bolt's cast time reduced by {$s3=30}%][]
  • description:{$@spelldesc117896=When you cast Conflagrate, the cast time and mana cost of your next Chaos Bolt or next three Incinerates is reduced by {$117828s1=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 24.31% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul (dark_soul) 3.0 0.0 120.9sec 121.0sec 19.27% 42.58% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:19.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113858
  • name:Dark Soul: Instability
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 238.5sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
nightmare_fire 2.9 0.0 124.1sec 124.0sec 18.41% 18.43% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Candylicious
chaos_bolt Burning Ember 24.6 24.6 1.0 1.0 64188.7
conflagrate Mana 26.4 168746.1 6400.0 6400.0 3.3
dark_soul Mana 3.0 24013.1 8000.0 8000.0 0.0
immolate Mana 20.6 395470.5 19200.0 19200.1 2.1
incinerate Mana 137.2 3640847.6 26538.0 26538.0 0.5
pet - terrorguard
doom_bolt Energy 105.4 3687.4 35.0 35.0 496.9
Resource Gains Type Count Total Average Overflow
incinerate Burning Ember 137.19 17.17 (70.54%) 0.13 0.00 0.00%
immolate Burning Ember 37.73 3.77 (15.50%) 0.10 0.00 0.00%
conflagrate Burning Ember 26.37 3.40 (13.95%) 0.13 0.00 0.00%
external_healing Health 8.75 0.00 (0.00%) 0.00 81317.19 100.00%
mp5_regen Mana 298.40 4162241.72 (100.00%) 13948.52 52481.56 1.25%
soul_leech Health 136.29 0.00 (0.00%) 0.00 268761.72 100.00%
siphon_life Health 120.74 0.00 (0.00%) 0.00 1253787.17 100.00%
pet - terrorguard
energy_regen Energy 499.49 3622.54 (100.00%) 7.25 3.99 0.11%
Resource RPS-Gain RPS-Loss
Mana 13830.19 14052.24
Burning Ember 0.08 0.08
Combat End Resource Mean Min Max
Mana 101051.97 17304.08 162234.67
Burning Ember 0.59 0.00 1.50
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%
felhunter-Mana Cap 1.1%
imp-Mana Cap 1.1%
succubus-Mana Cap 1.1%
voidwalker-Mana Cap 1.1%
infernal-Mana Cap 1.1%
doomguard-Mana Cap 1.1%
observer-Mana Cap 1.1%
fel_imp-Mana Cap 1.1%
shivarra-Mana Cap 1.1%
voidlord-Mana Cap 1.1%
abyssal-Mana Cap 1.1%
terrorguard-Mana Cap 1.1%
service_felhunter-Mana Cap 1.1%
service_imp-Mana Cap 1.1%
service_succubus-Mana Cap 1.1%
service_voidwalker-Mana Cap 1.1%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Candylicious Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Candylicious Damage Per Second
Count 25000
Mean 22830.63
Minimum 20859.38
Maximum 25064.04
Spread ( max - min ) 4204.66
Range [ ( max - min ) / 2 * 100% ] 9.21%
Standard Deviation 572.3006
5th Percentile 21898.74
95th Percentile 23770.01
( 95th Percentile - 5th Percentile ) 1871.27
Mean Distribution
Standard Deviation 3.6195
95.00% Confidence Intervall ( 22823.54 - 22837.72 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2413
0.1 Scale Factor Error with Delta=300 2795
0.05 Scale Factor Error with Delta=300 11183
0.01 Scale Factor Error with Delta=300 279596
Distribution Chart
DPS(e)
Sample Data Candylicious Damage Per Second (Effective)
Count 25000
Mean 22830.63
Minimum 20859.38
Maximum 25064.04
Spread ( max - min ) 4204.66
Range [ ( max - min ) / 2 * 100% ] 9.21%
Damage
Sample Data Candylicious Damage
Count 25000
Mean 5026307.54
Minimum 3622295.09
Maximum 6366090.59
Spread ( max - min ) 2743795.51
Range [ ( max - min ) / 2 * 100% ] 27.29%
DTPS
Sample Data Candylicious Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Candylicious Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Candylicious Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Candylicious Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Candylicious Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Candylicious Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CandyliciousTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Candylicious Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
4 0.00 summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
5 0.00 summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
6 0.00 snapshot_stats
7 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
8 0.00 service_pet,if=talent.grimoire_of_service.enabled
9 0.00 potion,name=draenic_intellect
A 0.00 incinerate
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
C 0.00 berserking
D 0.00 blood_fury
E 0.00 arcane_torrent
F 0.00 mannoroths_fury
G 3.00 dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
H 0.00 service_pet,if=talent.grimoire_of_service.enabled
I 0.00 summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
J 0.00 summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
K 0.00 run_action_list,name=single_target,if=active_enemies<6
L 0.00 run_action_list,name=aoe,if=active_enemies>=6
actions.single_target
# count action,conditions
M 0.00 havoc,target=2
N 0.00 shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
O 0.00 cataclysm,if=active_enemies>1
P 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
Q 1.70 immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
R 0.00 cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
S 0.00 shadowburn,if=buff.havoc.remains
T 0.00 chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
U 1.00 conflagrate,if=charges=2
V 0.00 cataclysm
W 0.00 rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
X 0.00 chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
Y 0.00 chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
Z 22.88 chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
a 0.00 chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
b 0.00 chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
c 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
d 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
e 1.91 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
f 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
g 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
h 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
i 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
j 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
k 18.99 immolate,cycle_targets=1,if=remains<=(duration*0.3)
l 25.37 conflagrate
m 136.83 incinerate

Sample Sequence

0149AGQUlmmmmZZmmklmZmmmmmmelkmmmmmmmmlmmmkmmmmlmmmmmkmlmmmZmmklmmmmZmmlkmmmmZmlmmkmmmZlmmmmkmGZZZlmmmZklmmZmmmlmkmmmmmmlmmmkmmmlmmmmkmmlmZmmmmklmmmZmmmklmmmZmmlmmkmZmlmmmmmZQGZBZlmmZmklmmZmmmmlmkmmmmmmlmZZkmmmlmmmZkmm

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre food Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre summon_terrorguard Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember draenic_intellect_potion
0:00.000 incinerate Fluffy_Pillow 136000.0/168000: 81% mana | 1.1/4: 28% burning_ember draenic_intellect_potion
0:00.000 dark_soul Fluffy_Pillow 136000.0/168000: 81% mana | 1.0/4: 25% burning_ember draenic_intellect_potion
0:00.000 immolate Fluffy_Pillow 128000.0/168000: 76% mana | 1.0/4: 25% burning_ember dark_soul, draenic_intellect_potion
0:01.294 conflagrate Fluffy_Pillow 131495.2/168000: 78% mana | 1.0/4: 25% burning_ember bloodlust, dark_soul, draenic_intellect_potion
0:02.299 conflagrate Fluffy_Pillow 142721.7/168000: 85% mana | 1.2/4: 30% burning_ember bloodlust, backdraft(3), dark_soul, draenic_intellect_potion
0:03.302 incinerate Fluffy_Pillow 153913.1/168000: 92% mana | 1.5/4: 38% burning_ember bloodlust, backdraft(6), dark_soul, draenic_intellect_potion
0:04.306 incinerate Fluffy_Pillow 149122.1/168000: 89% mana | 1.7/4: 43% burning_ember bloodlust, backdraft(5), dark_soul, draenic_intellect_potion
0:05.310 incinerate Fluffy_Pillow 144331.0/168000: 86% mana | 1.8/4: 45% burning_ember bloodlust, backdraft(4), dark_soul, draenic_intellect_potion
0:06.315 incinerate Fluffy_Pillow 139557.5/168000: 83% mana | 2.0/4: 50% burning_ember bloodlust, backdraft(3), dark_soul, draenic_intellect_potion
0:07.319 chaos_bolt Fluffy_Pillow 134766.5/168000: 80% mana | 2.2/4: 55% burning_ember bloodlust, backdraft(2), dark_soul, draenic_intellect_potion
0:08.976 chaos_bolt Fluffy_Pillow 163828.3/168000: 98% mana | 1.2/4: 30% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:10.633 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.2/4: 5% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:11.638 incinerate Fluffy_Pillow 163226.5/168000: 97% mana | 0.4/4: 10% burning_ember bloodlust, backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
0:12.644 immolate Fluffy_Pillow 158470.5/168000: 94% mana | 0.5/4: 13% burning_ember bloodlust, dark_soul, nightmare_fire, draenic_intellect_potion
0:13.649 conflagrate Fluffy_Pillow 156897.0/168000: 93% mana | 0.6/4: 15% burning_ember bloodlust, dark_soul, nightmare_fire, draenic_intellect_potion
0:14.652 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.8/4: 20% burning_ember bloodlust, backdraft(3), dark_soul, nightmare_fire, draenic_intellect_potion
0:15.656 chaos_bolt Fluffy_Pillow 163209.0/168000: 97% mana | 1.1/4: 28% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:17.312 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.1/4: 3% burning_ember bloodlust, backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
0:18.317 incinerate Fluffy_Pillow 163226.5/168000: 97% mana | 0.3/4: 8% burning_ember bloodlust, backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
0:19.321 incinerate Fluffy_Pillow 158435.4/168000: 94% mana | 0.5/4: 13% burning_ember bloodlust, dark_soul, nightmare_fire, draenic_intellect_potion
0:20.648 incinerate Fluffy_Pillow 147365.1/168000: 88% mana | 0.6/4: 15% burning_ember bloodlust, nightmare_fire
0:21.975 incinerate Fluffy_Pillow 138639.1/168000: 83% mana | 0.8/4: 20% burning_ember bloodlust, nightmare_fire
0:23.301 incinerate Fluffy_Pillow 129895.6/168000: 77% mana | 0.9/4: 23% burning_ember bloodlust, nightmare_fire
0:24.627 chaos_bolt Fluffy_Pillow 121152.0/168000: 72% mana | 1.0/4: 25% burning_ember bloodlust, nightmare_fire
0:26.284 conflagrate Fluffy_Pillow 150213.8/168000: 89% mana | 0.0/4: 0% burning_ember bloodlust, nightmare_fire
0:27.289 immolate Fluffy_Pillow 161440.3/168000: 96% mana | 0.2/4: 5% burning_ember bloodlust, backdraft(3), nightmare_fire
0:28.294 incinerate Fluffy_Pillow 159866.8/168000: 95% mana | 0.2/4: 5% burning_ember bloodlust, backdraft(3), nightmare_fire
0:29.298 incinerate Fluffy_Pillow 155075.8/168000: 92% mana | 0.4/4: 10% burning_ember bloodlust, backdraft(2)
0:30.302 incinerate Fluffy_Pillow 150284.7/168000: 89% mana | 0.5/4: 13% burning_ember bloodlust, backdraft
0:31.307 incinerate Fluffy_Pillow 145511.2/168000: 87% mana | 0.7/4: 18% burning_ember bloodlust
0:32.632 incinerate Fluffy_Pillow 136750.1/168000: 81% mana | 0.8/4: 20% burning_ember bloodlust
0:33.958 incinerate Fluffy_Pillow 128006.6/168000: 76% mana | 0.9/4: 22% burning_ember bloodlust
0:35.285 incinerate Fluffy_Pillow 119280.5/168000: 71% mana | 1.0/4: 25% burning_ember bloodlust
0:36.611 incinerate Fluffy_Pillow 110537.0/168000: 66% mana | 1.1/4: 27% burning_ember bloodlust
0:37.937 conflagrate Fluffy_Pillow 101793.4/168000: 61% mana | 1.2/4: 30% burning_ember bloodlust
0:38.941 incinerate Fluffy_Pillow 113002.4/168000: 67% mana | 1.4/4: 35% burning_ember bloodlust, backdraft(3)
0:39.945 incinerate Fluffy_Pillow 108211.4/168000: 64% mana | 1.6/4: 40% burning_ember bloodlust, backdraft(2)
0:40.951 incinerate Fluffy_Pillow 103455.4/168000: 62% mana | 1.7/4: 43% burning_ember bloodlust, backdraft
0:41.956 immolate Fluffy_Pillow 94614.2/168000: 56% mana | 1.9/4: 48% burning_ember
0:43.250 incinerate Fluffy_Pillow 92872.1/168000: 55% mana | 1.9/4: 48% burning_ember
0:44.973 incinerate Fluffy_Pillow 84117.7/168000: 50% mana | 2.0/4: 50% burning_ember
0:46.695 incinerate Fluffy_Pillow 75349.9/168000: 45% mana | 2.1/4: 53% burning_ember
0:48.419 incinerate Fluffy_Pillow 66609.0/168000: 40% mana | 2.2/4: 55% burning_ember
0:50.142 conflagrate Fluffy_Pillow 57854.7/168000: 34% mana | 2.3/4: 58% burning_ember
0:51.145 incinerate Fluffy_Pillow 64986.6/168000: 39% mana | 2.4/4: 60% burning_ember backdraft(3)
0:52.352 incinerate Fluffy_Pillow 58870.7/168000: 35% mana | 2.5/4: 63% burning_ember backdraft(2)
0:53.560 incinerate Fluffy_Pillow 52768.2/168000: 31% mana | 2.6/4: 65% burning_ember backdraft
0:54.767 incinerate Fluffy_Pillow 46652.3/168000: 28% mana | 2.7/4: 68% burning_ember
0:56.491 incinerate Fluffy_Pillow 37911.5/168000: 23% mana | 2.9/4: 73% burning_ember
0:58.217 immolate Fluffy_Pillow 29197.6/168000: 17% mana | 3.0/4: 75% burning_ember
0:59.509 Waiting 0.400 sec 27428.5/168000: 16% mana | 3.0/4: 75% burning_ember
0:59.909 incinerate Fluffy_Pillow 32825.0/168000: 20% mana | 3.0/4: 75% burning_ember
1:01.632 conflagrate Fluffy_Pillow 24070.7/168000: 14% mana | 3.1/4: 78% burning_ember
1:02.637 incinerate Fluffy_Pillow 31229.5/168000: 19% mana | 3.2/4: 80% burning_ember backdraft(3)
1:03.846 incinerate Fluffy_Pillow 25140.6/168000: 15% mana | 3.3/4: 83% burning_ember backdraft(2)
1:05.054 Waiting 0.300 sec 19038.2/168000: 11% mana | 3.4/4: 85% burning_ember backdraft
1:05.354 incinerate Fluffy_Pillow 23085.6/168000: 14% mana | 3.4/4: 85% burning_ember backdraft
1:06.561 chaos_bolt Fluffy_Pillow 16969.7/168000: 10% mana | 3.6/4: 90% burning_ember
1:08.715 incinerate Fluffy_Pillow 46030.2/168000: 27% mana | 2.6/4: 65% burning_ember
1:10.438 incinerate Fluffy_Pillow 37275.8/168000: 22% mana | 2.8/4: 70% burning_ember
1:12.161 immolate Fluffy_Pillow 28521.5/168000: 17% mana | 2.9/4: 73% burning_ember
1:13.455 conflagrate Fluffy_Pillow 26779.3/168000: 16% mana | 2.9/4: 73% burning_ember
1:14.460 incinerate Fluffy_Pillow 33938.2/168000: 20% mana | 3.1/4: 78% burning_ember backdraft(3)
1:15.666 incinerate Fluffy_Pillow 27808.8/168000: 17% mana | 3.2/4: 80% burning_ember backdraft(2)
1:16.874 Waiting 0.100 sec 21706.4/168000: 13% mana | 3.3/4: 83% burning_ember backdraft
1:16.974 incinerate Fluffy_Pillow 23055.5/168000: 14% mana | 3.3/4: 83% burning_ember backdraft
1:18.182 Waiting 1.200 sec 16953.1/168000: 10% mana | 3.4/4: 85% burning_ember
1:19.382 incinerate Fluffy_Pillow 33142.8/168000: 20% mana | 3.4/4: 85% burning_ember
1:21.106 chaos_bolt Fluffy_Pillow 24401.9/168000: 15% mana | 3.5/4: 88% burning_ember
1:23.261 incinerate Fluffy_Pillow 53475.8/168000: 32% mana | 2.5/4: 63% burning_ember
1:24.983 incinerate Fluffy_Pillow 44708.0/168000: 27% mana | 2.6/4: 65% burning_ember
1:26.705 conflagrate Fluffy_Pillow 35940.2/168000: 21% mana | 2.8/4: 70% burning_ember
1:27.710 immolate Fluffy_Pillow 43099.0/168000: 26% mana | 3.0/4: 75% burning_ember backdraft(3)
1:29.003 incinerate Fluffy_Pillow 41343.4/168000: 25% mana | 3.0/4: 75% burning_ember backdraft(3)
1:30.211 incinerate Fluffy_Pillow 35241.0/168000: 21% mana | 3.1/4: 78% burning_ember backdraft(2)
1:31.418 incinerate Fluffy_Pillow 29125.1/168000: 17% mana | 3.2/4: 80% burning_ember backdraft
1:32.627 Waiting 0.700 sec 23036.1/168000: 14% mana | 3.4/4: 85% burning_ember
1:33.327 incinerate Fluffy_Pillow 32480.1/168000: 19% mana | 3.4/4: 85% burning_ember
1:35.050 chaos_bolt Fluffy_Pillow 23725.8/168000: 14% mana | 3.5/4: 88% burning_ember
1:37.202 incinerate Fluffy_Pillow 52759.2/168000: 31% mana | 2.5/4: 63% burning_ember
1:38.926 conflagrate Fluffy_Pillow 44018.4/168000: 26% mana | 2.6/4: 65% burning_ember
1:39.932 incinerate Fluffy_Pillow 51190.7/168000: 30% mana | 2.7/4: 68% burning_ember backdraft(3)
1:41.139 incinerate Fluffy_Pillow 45074.8/168000: 27% mana | 2.8/4: 70% burning_ember backdraft(2)
1:42.347 immolate Fluffy_Pillow 38972.4/168000: 23% mana | 3.0/4: 75% burning_ember backdraft
1:43.640 incinerate Fluffy_Pillow 37216.8/168000: 22% mana | 3.1/4: 78% burning_ember backdraft
1:44.848 Waiting 0.100 sec 31114.4/168000: 19% mana | 3.2/4: 80% burning_ember
1:44.948 incinerate Fluffy_Pillow 32463.5/168000: 19% mana | 3.2/4: 80% burning_ember
1:46.672 Waiting 0.700 sec 23722.6/168000: 14% mana | 3.3/4: 83% burning_ember
1:47.372 incinerate Fluffy_Pillow 33166.6/168000: 20% mana | 3.3/4: 83% burning_ember
1:49.095 chaos_bolt Fluffy_Pillow 24412.3/168000: 15% mana | 3.5/4: 88% burning_ember
1:51.248 conflagrate Fluffy_Pillow 53459.2/168000: 32% mana | 2.6/4: 65% burning_ember
1:52.253 incinerate Fluffy_Pillow 60618.0/168000: 36% mana | 2.7/4: 68% burning_ember backdraft(3)
1:53.461 incinerate Fluffy_Pillow 54515.6/168000: 32% mana | 2.8/4: 70% burning_ember backdraft(2)
1:54.670 incinerate Fluffy_Pillow 48426.7/168000: 29% mana | 2.9/4: 73% burning_ember backdraft
1:55.878 incinerate Fluffy_Pillow 42324.3/168000: 25% mana | 3.2/4: 80% burning_ember
1:57.603 immolate Fluffy_Pillow 33597.0/168000: 20% mana | 3.3/4: 83% burning_ember
1:58.897 Waiting 0.100 sec 31854.8/168000: 19% mana | 3.3/4: 83% burning_ember
1:58.997 incinerate Fluffy_Pillow 33203.9/168000: 20% mana | 3.3/4: 83% burning_ember
2:00.721 dark_soul Fluffy_Pillow 24463.1/168000: 15% mana | 3.4/4: 85% burning_ember
2:00.721 chaos_bolt Fluffy_Pillow 16463.1/168000: 10% mana | 3.4/4: 85% burning_ember dark_soul
2:02.875 chaos_bolt Fluffy_Pillow 45523.5/168000: 27% mana | 2.4/4: 60% burning_ember dark_soul
2:05.027 chaos_bolt Fluffy_Pillow 74557.0/168000: 44% mana | 1.5/4: 38% burning_ember dark_soul
2:07.181 conflagrate Fluffy_Pillow 103617.4/168000: 62% mana | 0.5/4: 13% burning_ember dark_soul, nightmare_fire
2:08.184 incinerate Fluffy_Pillow 110749.3/168000: 66% mana | 0.7/4: 18% burning_ember backdraft(3), dark_soul, nightmare_fire
2:09.393 incinerate Fluffy_Pillow 104660.4/168000: 62% mana | 0.8/4: 20% burning_ember backdraft(2), dark_soul, nightmare_fire
2:10.601 incinerate Fluffy_Pillow 98558.0/168000: 59% mana | 0.9/4: 23% burning_ember backdraft, dark_soul, nightmare_fire
2:11.810 chaos_bolt Fluffy_Pillow 92469.0/168000: 55% mana | 1.2/4: 30% burning_ember dark_soul, nightmare_fire
2:13.963 immolate Fluffy_Pillow 121516.0/168000: 72% mana | 0.2/4: 5% burning_ember dark_soul, nightmare_fire
2:15.256 conflagrate Fluffy_Pillow 119760.4/168000: 71% mana | 0.3/4: 8% burning_ember dark_soul, nightmare_fire
2:16.261 incinerate Fluffy_Pillow 126919.2/168000: 76% mana | 0.6/4: 15% burning_ember backdraft(3), dark_soul, nightmare_fire
2:17.468 incinerate Fluffy_Pillow 120803.3/168000: 72% mana | 0.8/4: 20% burning_ember backdraft(2), dark_soul, nightmare_fire
2:18.677 chaos_bolt Fluffy_Pillow 114714.4/168000: 68% mana | 1.0/4: 25% burning_ember backdraft, dark_soul, nightmare_fire
2:20.831 incinerate Fluffy_Pillow 143774.8/168000: 86% mana | 0.0/4: 0% burning_ember backdraft, nightmare_fire
2:22.037 incinerate Fluffy_Pillow 137645.4/168000: 82% mana | 0.2/4: 5% burning_ember nightmare_fire
2:23.759 incinerate Fluffy_Pillow 128877.6/168000: 77% mana | 0.4/4: 10% burning_ember nightmare_fire
2:25.482 conflagrate Fluffy_Pillow 120123.3/168000: 72% mana | 0.5/4: 13% burning_ember nightmare_fire
2:26.485 incinerate Fluffy_Pillow 127255.1/168000: 76% mana | 0.6/4: 15% burning_ember backdraft(3), nightmare_fire
2:27.691 immolate Fluffy_Pillow 121125.7/168000: 72% mana | 0.7/4: 18% burning_ember backdraft(2)
2:28.986 incinerate Fluffy_Pillow 119397.1/168000: 71% mana | 0.7/4: 18% burning_ember backdraft(2)
2:30.193 incinerate Fluffy_Pillow 113281.2/168000: 67% mana | 0.8/4: 20% burning_ember backdraft
2:31.401 incinerate Fluffy_Pillow 107178.8/168000: 64% mana | 0.9/4: 23% burning_ember
2:33.125 incinerate Fluffy_Pillow 98437.9/168000: 59% mana | 1.0/4: 25% burning_ember
2:34.850 incinerate Fluffy_Pillow 89710.5/168000: 53% mana | 1.2/4: 30% burning_ember
2:36.573 incinerate Fluffy_Pillow 80956.2/168000: 48% mana | 1.4/4: 35% burning_ember
2:38.296 conflagrate Fluffy_Pillow 72201.8/168000: 43% mana | 1.5/4: 38% burning_ember
2:39.300 incinerate Fluffy_Pillow 79347.2/168000: 47% mana | 1.7/4: 43% burning_ember backdraft(3)
2:40.507 incinerate Fluffy_Pillow 73231.3/168000: 44% mana | 1.8/4: 45% burning_ember backdraft(2)
2:41.715 incinerate Fluffy_Pillow 67128.9/168000: 40% mana | 1.9/4: 48% burning_ember backdraft
2:42.922 immolate Fluffy_Pillow 61013.0/168000: 36% mana | 2.0/4: 50% burning_ember
2:44.215 incinerate Fluffy_Pillow 59257.3/168000: 35% mana | 2.0/4: 50% burning_ember
2:45.938 incinerate Fluffy_Pillow 50503.0/168000: 30% mana | 2.1/4: 53% burning_ember
2:47.661 incinerate Fluffy_Pillow 41748.7/168000: 25% mana | 2.2/4: 55% burning_ember
2:49.385 conflagrate Fluffy_Pillow 33007.8/168000: 20% mana | 2.4/4: 60% burning_ember
2:50.389 incinerate Fluffy_Pillow 40153.2/168000: 24% mana | 2.5/4: 63% burning_ember backdraft(3)
2:51.596 incinerate Fluffy_Pillow 34037.3/168000: 20% mana | 2.6/4: 65% burning_ember backdraft(2)
2:52.806 incinerate Fluffy_Pillow 27961.8/168000: 17% mana | 2.7/4: 68% burning_ember backdraft
2:54.013 Waiting 0.800 sec 21845.9/168000: 13% mana | 2.8/4: 70% burning_ember
2:54.813 incinerate Fluffy_Pillow 32639.0/168000: 19% mana | 2.8/4: 70% burning_ember
2:56.536 Waiting 0.300 sec 23884.7/168000: 14% mana | 2.9/4: 73% burning_ember
2:56.836 immolate Fluffy_Pillow 27932.1/168000: 17% mana | 2.9/4: 73% burning_ember
2:58.130 Waiting 0.500 sec 26190.0/168000: 16% mana | 2.9/4: 73% burning_ember
2:58.630 incinerate Fluffy_Pillow 32935.6/168000: 20% mana | 2.9/4: 73% burning_ember
3:00.354 Waiting 0.600 sec 24194.8/168000: 14% mana | 3.1/4: 78% burning_ember
3:00.954 incinerate Fluffy_Pillow 32289.6/168000: 19% mana | 3.1/4: 78% burning_ember
3:02.677 conflagrate Fluffy_Pillow 23535.3/168000: 14% mana | 3.2/4: 80% burning_ember
3:03.682 incinerate Fluffy_Pillow 30694.1/168000: 18% mana | 3.3/4: 83% burning_ember backdraft(3)
3:04.889 chaos_bolt Fluffy_Pillow 24578.2/168000: 15% mana | 3.5/4: 88% burning_ember backdraft(2)
3:07.043 incinerate Fluffy_Pillow 53638.7/168000: 32% mana | 2.5/4: 63% burning_ember backdraft(2)
3:08.251 incinerate Fluffy_Pillow 47536.3/168000: 28% mana | 2.6/4: 65% burning_ember backdraft
3:09.458 incinerate Fluffy_Pillow 41420.4/168000: 25% mana | 2.8/4: 70% burning_ember
3:11.181 incinerate Fluffy_Pillow 32666.0/168000: 19% mana | 2.9/4: 73% burning_ember
3:12.903 immolate Fluffy_Pillow 23898.2/168000: 14% mana | 3.0/4: 75% burning_ember
3:14.198 conflagrate Fluffy_Pillow 22169.5/168000: 13% mana | 3.0/4: 75% burning_ember
3:15.202 incinerate Fluffy_Pillow 29314.9/168000: 17% mana | 3.1/4: 78% burning_ember backdraft(3)
3:16.411 incinerate Fluffy_Pillow 23225.9/168000: 14% mana | 3.2/4: 80% burning_ember backdraft(2)
3:17.619 Waiting 0.400 sec 17123.5/168000: 10% mana | 3.4/4: 85% burning_ember backdraft
3:18.019 incinerate Fluffy_Pillow 22520.1/168000: 13% mana | 3.4/4: 85% burning_ember backdraft
3:19.227 chaos_bolt Fluffy_Pillow 16417.7/168000: 10% mana | 3.5/4: 88% burning_ember
3:21.380 incinerate Fluffy_Pillow 45464.6/168000: 27% mana | 2.5/4: 63% burning_ember
3:23.104 incinerate Fluffy_Pillow 36723.8/168000: 22% mana | 2.6/4: 65% burning_ember
3:24.826 Waiting 0.300 sec 27955.9/168000: 17% mana | 2.8/4: 70% burning_ember
3:25.126 incinerate Fluffy_Pillow 32003.4/168000: 19% mana | 2.8/4: 70% burning_ember
3:26.848 immolate Fluffy_Pillow 23235.5/168000: 14% mana | 3.0/4: 75% burning_ember
3:28.143 conflagrate Fluffy_Pillow 21506.9/168000: 13% mana | 3.0/4: 75% burning_ember
3:29.148 incinerate Fluffy_Pillow 28665.7/168000: 17% mana | 3.1/4: 78% burning_ember backdraft(3)
3:30.356 incinerate Fluffy_Pillow 22563.3/168000: 13% mana | 3.2/4: 80% burning_ember backdraft(2)
3:31.564 Waiting 0.500 sec 16460.9/168000: 10% mana | 3.4/4: 85% burning_ember backdraft
3:32.064 incinerate Fluffy_Pillow 23206.6/168000: 14% mana | 3.4/4: 85% burning_ember backdraft
3:33.270 chaos_bolt Fluffy_Pillow 17077.2/168000: 10% mana | 3.6/4: 90% burning_ember
3:35.424 incinerate Fluffy_Pillow 46137.6/168000: 27% mana | 2.6/4: 65% burning_ember
3:37.148 incinerate Fluffy_Pillow 37396.8/168000: 22% mana | 2.7/4: 68% burning_ember
3:38.872 conflagrate Fluffy_Pillow 28655.9/168000: 17% mana | 2.9/4: 73% burning_ember
3:39.878 incinerate Fluffy_Pillow 35828.3/168000: 21% mana | 3.1/4: 78% burning_ember backdraft(3)
3:41.086 incinerate Fluffy_Pillow 29725.9/168000: 18% mana | 3.2/4: 80% burning_ember backdraft(2)
3:42.293 immolate Fluffy_Pillow 23610.0/168000: 14% mana | 3.3/4: 83% burning_ember backdraft
3:43.585 Waiting 0.100 sec 21840.8/168000: 13% mana | 3.3/4: 83% burning_ember backdraft
3:43.685 incinerate Fluffy_Pillow 23190.0/168000: 14% mana | 3.3/4: 83% burning_ember backdraft
3:44.892 Waiting 1.200 sec 17074.1/168000: 10% mana | 3.4/4: 85% burning_ember
3:46.092 chaos_bolt Fluffy_Pillow 33263.7/168000: 20% mana | 3.5/4: 88% burning_ember
3:48.244 incinerate Fluffy_Pillow 62297.2/168000: 37% mana | 2.5/4: 63% burning_ember
3:49.965 conflagrate Fluffy_Pillow 53515.9/168000: 32% mana | 2.6/4: 65% burning_ember
3:50.970 incinerate Fluffy_Pillow 60674.7/168000: 36% mana | 2.7/4: 68% burning_ember backdraft(3)
3:52.178 incinerate Fluffy_Pillow 54572.3/168000: 32% mana | 2.9/4: 73% burning_ember backdraft(2)
3:53.387 incinerate Fluffy_Pillow 48483.4/168000: 29% mana | 3.0/4: 75% burning_ember backdraft
3:54.593 incinerate Fluffy_Pillow 42354.0/168000: 25% mana | 3.2/4: 80% burning_ember
3:56.318 incinerate Fluffy_Pillow 33626.6/168000: 20% mana | 3.3/4: 83% burning_ember
3:58.042 chaos_bolt Fluffy_Pillow 24885.8/168000: 15% mana | 3.5/4: 88% burning_ember
4:00.194 immolate Fluffy_Pillow 53919.2/168000: 32% mana | 2.6/4: 65% burning_ember
4:01.490 dark_soul Fluffy_Pillow 52204.1/168000: 31% mana | 2.6/4: 65% burning_ember
4:01.490 chaos_bolt Fluffy_Pillow 44204.1/168000: 26% mana | 2.6/4: 65% burning_ember dark_soul
4:03.644 potion Fluffy_Pillow 73264.5/168000: 44% mana | 1.6/4: 40% burning_ember dark_soul
4:03.644 chaos_bolt Fluffy_Pillow 73264.5/168000: 44% mana | 1.6/4: 40% burning_ember dark_soul, draenic_intellect_potion
4:05.798 conflagrate Fluffy_Pillow 102324.9/168000: 61% mana | 0.6/4: 15% burning_ember dark_soul, draenic_intellect_potion
4:06.802 incinerate Fluffy_Pillow 109470.3/168000: 65% mana | 0.7/4: 18% burning_ember backdraft(3), dark_soul, draenic_intellect_potion
4:08.009 incinerate Fluffy_Pillow 103354.4/168000: 62% mana | 0.8/4: 20% burning_ember backdraft(2), dark_soul, draenic_intellect_potion
4:09.216 chaos_bolt Fluffy_Pillow 97238.5/168000: 58% mana | 1.0/4: 25% burning_ember backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
4:11.370 incinerate Fluffy_Pillow 126298.9/168000: 75% mana | 0.1/4: 3% burning_ember backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
4:12.578 immolate Fluffy_Pillow 120196.5/168000: 72% mana | 0.3/4: 8% burning_ember dark_soul, nightmare_fire, draenic_intellect_potion
4:13.873 conflagrate Fluffy_Pillow 118467.9/168000: 71% mana | 0.4/4: 10% burning_ember dark_soul, nightmare_fire, draenic_intellect_potion
4:14.877 incinerate Fluffy_Pillow 125613.2/168000: 75% mana | 0.6/4: 15% burning_ember backdraft(3), dark_soul, nightmare_fire, draenic_intellect_potion
4:16.086 incinerate Fluffy_Pillow 119524.3/168000: 71% mana | 0.7/4: 18% burning_ember backdraft(2), dark_soul, nightmare_fire, draenic_intellect_potion
4:17.294 chaos_bolt Fluffy_Pillow 113421.9/168000: 68% mana | 1.0/4: 25% burning_ember backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
4:19.447 incinerate Fluffy_Pillow 142468.8/168000: 85% mana | 0.0/4: 0% burning_ember backdraft, dark_soul, nightmare_fire, draenic_intellect_potion
4:20.654 incinerate Fluffy_Pillow 136352.9/168000: 81% mana | 0.1/4: 3% burning_ember dark_soul, nightmare_fire, draenic_intellect_potion
4:22.378 incinerate Fluffy_Pillow 127612.1/168000: 76% mana | 0.2/4: 5% burning_ember nightmare_fire, draenic_intellect_potion
4:24.101 incinerate Fluffy_Pillow 118857.7/168000: 71% mana | 0.4/4: 10% burning_ember nightmare_fire, draenic_intellect_potion
4:25.824 conflagrate Fluffy_Pillow 110103.4/168000: 66% mana | 0.6/4: 15% burning_ember nightmare_fire, draenic_intellect_potion
4:26.829 incinerate Fluffy_Pillow 117262.2/168000: 70% mana | 0.7/4: 18% burning_ember backdraft(3), nightmare_fire, draenic_intellect_potion
4:28.037 immolate Fluffy_Pillow 111159.8/168000: 66% mana | 0.8/4: 20% burning_ember backdraft(2), nightmare_fire, draenic_intellect_potion
4:29.331 incinerate Fluffy_Pillow 109417.7/168000: 65% mana | 0.8/4: 20% burning_ember backdraft(2)
4:30.540 incinerate Fluffy_Pillow 103328.8/168000: 62% mana | 1.0/4: 25% burning_ember backdraft
4:31.746 incinerate Fluffy_Pillow 97199.4/168000: 58% mana | 1.1/4: 28% burning_ember
4:33.471 incinerate Fluffy_Pillow 88472.0/168000: 53% mana | 1.2/4: 30% burning_ember
4:35.195 incinerate Fluffy_Pillow 79731.2/168000: 47% mana | 1.4/4: 35% burning_ember
4:36.918 incinerate Fluffy_Pillow 70976.8/168000: 42% mana | 1.6/4: 40% burning_ember
4:38.640 conflagrate Fluffy_Pillow 62209.0/168000: 37% mana | 1.9/4: 48% burning_ember
4:39.645 incinerate Fluffy_Pillow 69367.8/168000: 41% mana | 2.0/4: 50% burning_ember backdraft(3)
4:40.852 chaos_bolt Fluffy_Pillow 63251.9/168000: 38% mana | 2.1/4: 53% burning_ember backdraft(2)
4:43.006 chaos_bolt Fluffy_Pillow 92312.4/168000: 55% mana | 1.1/4: 28% burning_ember backdraft(2)
4:45.160 immolate Fluffy_Pillow 121372.8/168000: 72% mana | 0.1/4: 3% burning_ember backdraft(2)
4:46.452 incinerate Fluffy_Pillow 119603.7/168000: 71% mana | 0.1/4: 3% burning_ember backdraft(2)
4:47.658 incinerate Fluffy_Pillow 113474.3/168000: 68% mana | 0.3/4: 8% burning_ember backdraft
4:48.865 incinerate Fluffy_Pillow 107358.4/168000: 64% mana | 0.4/4: 10% burning_ember
4:50.587 conflagrate Fluffy_Pillow 98590.5/168000: 59% mana | 0.5/4: 13% burning_ember
4:51.593 incinerate Fluffy_Pillow 105762.9/168000: 63% mana | 0.6/4: 15% burning_ember backdraft(3)
4:52.801 incinerate Fluffy_Pillow 99660.5/168000: 59% mana | 0.7/4: 18% burning_ember backdraft(2)
4:54.008 incinerate Fluffy_Pillow 93544.6/168000: 56% mana | 0.9/4: 23% burning_ember backdraft
4:55.214 chaos_bolt Fluffy_Pillow 87415.2/168000: 52% mana | 1.0/4: 25% burning_ember
4:57.367 immolate Fluffy_Pillow 116462.1/168000: 69% mana | 0.0/4: 0% burning_ember
4:58.659 incinerate Fluffy_Pillow 114693.0/168000: 68% mana | 0.0/4: 0% burning_ember
5:00.382 incinerate Fluffy_Pillow 105938.6/168000: 63% mana | 0.1/4: 3% burning_ember

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 573 546 546
Agility 1036 987 987
Stamina 4945 4495 4087
Intellect 4172 3711 3587 (2490)
Spirit 1155 1155 1155
Health 296700 269700 0
Mana 168000 168000 0
Burning Ember 4 4 0
Spell Power 5798 4810 1099
Crit 21.45% 15.49% 1154
Haste 16.31% 10.77% 967
Multistrike 15.15% 10.15% 670
Damage / Heal Versatility 3.60% 0.60% 78
ManaReg per Second 13491 12849 0
Mastery 50.28% 35.28% 414
Armor 669 669 659

Talents

Level
15 Dark Regeneration Soul Leech Searing Flames (Destruction Warlock)
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Horror Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Darkness Kil'jaeden's Cunning Mannoroth's Fury
100 Charred Remains Cataclysm Demonic Servitude

Profile

warlock="Candylicious"
origin="http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/213/75883733-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=700/inscription=189
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!1100012
glyphs=siphon_life/havoc/demon_training/nightmares/verdant_spheres
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
actions.precombat+=/summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
actions.precombat+=/summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
actions.precombat+=/service_pet,if=talent.grimoire_of_service.enabled
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/incinerate

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/mannoroths_fury
actions+=/dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
actions+=/summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
actions+=/run_action_list,name=single_target,if=active_enemies<6
actions+=/run_action_list,name=aoe,if=active_enemies>=6

actions.single_target=havoc,target=2
actions.single_target+=/shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
actions.single_target+=/cataclysm,if=active_enemies>1
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
actions.single_target+=/cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
actions.single_target+=/shadowburn,if=buff.havoc.remains
actions.single_target+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.single_target+=/conflagrate,if=charges=2
actions.single_target+=/cataclysm
actions.single_target+=/rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=(duration*0.3)
actions.single_target+=/conflagrate
actions.single_target+=/incinerate

actions.aoe=rain_of_fire,if=remains<=tick_time
actions.aoe+=/havoc,target=2
actions.aoe+=/shadowburn,if=buff.havoc.remains
actions.aoe+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.aoe+=/cataclysm
actions.aoe+=/fire_and_brimstone,if=buff.fire_and_brimstone.down
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&!dot.immolate.ticking
actions.aoe+=/conflagrate,if=buff.fire_and_brimstone.up&charges=2
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&dot.immolate.remains<=(dot.immolate.duration*0.3)
actions.aoe+=/chaos_bolt,if=talent.charred_remains.enabled&buff.fire_and_brimstone.up&burning_ember>=2.5
actions.aoe+=/incinerate

head=crown_of_power,id=118942
neck=odyssian_choker,id=113833,bonus_id=566,enchant=75crit
shoulders=mantle_of_volatile_ice,id=114517,bonus_id=148/560
back=cloak_of_searing_shadows,id=113847,enchant=gift_of_critical_strike
chest=robes_of_necrotic_whispers,id=113655,bonus_id=566
tabard=gnomeregan_tabard,id=45578
wrists=rotmonger_bracers,id=115999
hands=meatmongers_gory_grips,id=113610
waist=cord_of_winsome_sorrows,id=119336
legs=seacursed_leggings,id=113828,bonus_id=561/566
feet=sandals_of_volatile_ice,id=114501,bonus_id=37
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=kargaths_last_link,id=113604,bonus_id=566,enchant=50crit
trinket1=sandmans_pouch,id=112320,bonus_id=525/529
trinket2=grandiose_power,id=114550,bonus_id=40/563,gems=50crit
main_hand=meganas_staff_of_knowledge,id=115423,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_stamina=3197
# gear_intellect=2490
# gear_spell_power=1099
# gear_crit_rating=1099
# gear_haste_rating=967
# gear_mastery_rating=414
# gear_armor=659
# gear_multistrike_rating=670
# gear_versatility_rating=78
# gear_avoidance_rating=82
default_pet=felhunter

Dârkride

Dârkride : 22243 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22243.4 22243.4 7.9 / 0.035% 2489.1 / 11.2% 2604.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.5 Rage 0.00% 92.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced
Talents
  • 15: Double Time
  • 30: Enraged Regeneration
  • 45: Unyielding Strikes (Protection Warrior)
  • 60: Dragon Roar
  • 75: Vigilance
  • 90: Bloodbath
  • 100: Gladiator's Resolve (Protection Warrior)
  • Talent Calculator
Glyphs
  • Glyph of Enraged Speed
  • Glyph of Cleave
  • Glyph of Bull Rush
  • Glyph of Gushing Wound
  • Glyph of Bloodcurdling Shout
  • Glyph of Mystic Shout
Professions
  • mining: 700
  • blacksmithing: 666

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:22952|22909|15560|14143|8298|2465&chds=0,45904&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++22952++execute,C79C6E,0,0,15|t++22909++dragon_roar,C79C6E,1,0,15|t++15560++shield_slam,C79C6E,2,0,15|t++14143++revenge,C79C6E,3,0,15|t++8298++devastate,C79C6E,4,0,15|t++2465++auto_attack_mh,C79C6E,5,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,20,18,11,9,8,6,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=shield_slam|devastate|heroic_strike|auto_attack_mh|deep_wounds|revenge|bloodbath|execute|dragon_roar|shattered_bleed|heroic_leap&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:hkorsvz158663331zzywvtrqronljjjiihgghffffeddddddbbccbfghgjjkjlmlmpporsrpsppnnmkjkjgihgefedcdcbZbbacccacbcbbcaabcadeedffgfghggijhkkkijjighgfdffdeedbdccabcaabbabcbabbbabbaZbbZccdcdeddefdeggfghhfhgfeefcdddbcdcbcbaabbabbcacccaccabbcacddbdfeeggggiihjjkillkjkjhhihfggfdfedbdcbbccbcccbcdcbdcbbccbccdbddcdeedefgfghhghhggihggggefffdeeccdcccddbccdbdcbbcdbdcdccddceeddfeefeeccaYWWUSQPN&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.553468,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=22243|max=40189&chxp=1,1,55,100 Resolve Timeline Chart http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:5,3,7,15,20,38,48,79,135,196,260,353,453,635,785,916,1032,1165,1353,1426,1520,1524,1486,1379,1467,1222,1148,1047,959,811,747,570,507,414,287,266,198,151,113,79,63,38,36,15,14,6,2,3,2,2&chds=0,1524&chbh=5&chxt=x&chxl=0:|min=20088|avg=22243|max=24840&chxp=0,1,45,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:52.5,29.2,13.2,3.0,2.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=devastate 158.0s|shield_slam 87.9s|revenge 39.7s|execute 9.1s|dragon_roar 7.0s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Dârkride 22243
auto_attack_mh 2463 11.1% 133.3 2.27sec 5549 2465 Direct 133.3 4466 9034 5335 19.0% 17.8 1340 2711 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.35 133.35 0.00 0.00 2.2506 0.0000 739874.01 1137069.53 34.93 2465.41 2465.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.39 19.01% 2710.66 2374 3417 2620.82 0 3417 9187 14119 33.74
multistrike 14.44 80.99% 1339.59 1187 1708 1340.65 1211 1708 19346 29731 34.93
hit 107.99 80.99% 4466.08 3956 5694 4469.69 4313 4644 482295 741211 34.93
crit 25.35 19.01% 9033.66 7913 11389 9041.62 8291 10204 229046 352007 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
bloodbath 1266 5.7% 5.5 60.04sec 68653 0 Periodic 92.1 4115 0 4115 0.0% 0.0 0 0 0.0% 30.6%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.52 5.52 92.14 92.14 0.0000 1.0000 379212.60 379212.60 0.00 4115.43 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.1 100.00% 4115.43 388 12287 4125.71 3298 5334 379213 379213 0.00
 
DPS Timeline Chart
 

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc12292=For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deep_wounds 1963 8.8% 120.7 2.47sec 4889 0 Periodic 98.7 4828 9738 5753 18.8% 13.2 1449 2920 18.7% 98.4%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.74 120.74 98.66 98.66 0.0000 3.0000 590335.77 590335.77 0.00 1994.45 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.5 18.74% 2919.97 2567 3823 2666.85 0 3823 7217 7217 0.00
multistrike 10.7 81.26% 1448.70 1283 1912 1450.05 1283 1912 15522 15522 0.00
hit 80.1 81.16% 4827.56 4278 6372 4831.94 4646 5049 386549 386549 0.00
crit 18.6 18.84% 9738.12 8556 12744 9747.83 8770 11937 181047 181047 0.00
 
DPS Timeline Chart
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Cancelled if target reaches full health.
  • description:Your Mortal Strike, Bloodthirst, Devastate, and Thunder Clap cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}. This effect is cancelled if the target reaches full health.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.600000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
devastate 4364 19.6% 120.7 2.47sec 10855 8298 Direct 120.7 8731 17701 10436 19.0% 16.2 2619 5313 19.1%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.74 120.74 0.00 0.00 1.3082 0.0000 1310700.46 2014339.66 34.93 8297.62 8297.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.08 19.05% 5313.41 4652 6679 5068.02 0 6679 16359 25141 33.30
multistrike 13.08 80.95% 2618.92 2326 3339 2620.78 2349 3079 34262 52655 34.93
hit 97.79 80.99% 8730.69 7754 11131 8738.97 8449 9113 853747 1312074 34.93
crit 22.96 19.01% 17700.87 15507 22262 17707.53 16128 20214 406333 624469 34.93
 
DPS Timeline Chart
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:Deals $sw1 Physical damage, and has a {$46953s1=30}% chance to reset the cooldown on Shield Slam and cause it to generate $/10;50227s1 more Rage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
dragon_roar 536 2.4% 5.4 61.11sec 29919 22909 Direct 5.4 0 28753 28753 100.0% 0.7 0 8603 100.0%  

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 5.37 0.00 0.00 1.3060 0.0000 160683.06 160683.06 0.00 22908.91 22908.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.73 100.00% 8603.48 7057 10511 4518.40 0 10511 6261 6261 0.00
crit 5.37 100.00% 28752.90 23522 35038 28810.49 26693 30456 154422 154422 0.00
 
DPS Timeline Chart
 

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar explosively, dealing {$?s12712=false}[${$m1*1.25}][$m1] damage to all enemies within $A1 yards and knocking them back and down for {$118895d=500 milliseconds}. Damage ignores all armor and is always a critical strike.
 
execute 689 3.1% 6.6 7.95sec 31316 22952 Direct 6.6 25397 50860 30118 18.5% 0.9 7620 15249 18.3%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.64 6.64 0.00 0.00 1.3645 0.0000 207923.33 319545.33 34.93 22952.13 22952.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.16 18.34% 15248.57 14178 15596 2272.37 0 15596 2467 3792 5.20
multistrike 0.72 81.66% 7619.54 7089 7798 3922.90 0 7798 5490 8437 17.99
hit 5.41 81.46% 25396.83 23630 25993 25383.71 0 25993 137359 211099 34.92
crit 1.23 18.54% 50860.47 47260 51986 37367.13 0 51986 62607 96217 25.67
 
DPS Timeline Chart
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.sudden_death.react
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing $sw2 Physical damage{$?s23881=false}[ with your main-hand and $163558sw2 Physical damage with your off-hand][]. Only usable on enemies that have less than 20% health.{$?s146971=false}[ Successfully killing an enemy with Execute grants you {$147352s1=300 + 100.0%} rage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
heroic_leap 78 0.4% 6.9 46.04sec 3421 0 Direct 6.9 2729 5626 3293 19.5% 0.9 818 1689 19.3%  

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.86 0.00 0.00 0.0000 0.0000 23495.97 36109.60 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.18 19.26% 1688.57 1447 2156 272.49 0 2156 297 457 5.63
multistrike 0.74 80.74% 817.78 724 1078 434.32 0 1078 604 928 18.54
hit 5.53 80.55% 2729.20 2412 3593 2729.19 0 3593 15085 23183 34.93
crit 1.33 19.45% 5625.77 4823 7185 4375.70 0 7185 7509 11541 27.09
 
DPS Timeline Chart
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
 
heroic_strike 4050 18.2% 187.0 1.61sec 6503 0 Direct 187.0 4978 10188 6253 24.5% 24.9 1494 3058 24.5%  

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.02 187.02 0.00 0.00 0.0000 0.0000 1216257.42 1869195.62 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.10 24.47% 3057.66 2326 4173 3051.25 0 4173 18658 28675 34.84
multistrike 18.84 75.53% 1493.65 1163 2087 1495.06 1267 1775 28138 43243 34.93
hit 141.24 75.52% 4977.76 3876 6956 4982.16 4745 5220 703059 1080491 34.93
crit 45.78 24.48% 10187.86 7752 13911 10197.78 9281 11668 466402 716786 34.93
 
DPS Timeline Chart
 

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:Instantly deals $sw2 Physical damage{$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. This ability is not on the global cooldown.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.05
 
revenge 1869 8.4% 30.2 10.09sec 18612 14143 Direct 30.2 14993 30286 17894 19.0% 4.0 4501 9099 19.0%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.18 30.18 0.00 0.00 1.3160 0.0000 561744.77 863313.02 34.93 14142.97 14142.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.77 18.99% 9098.91 7013 13058 4903.12 0 13058 6973 10716 18.79
multistrike 3.27 81.01% 4500.99 3507 6529 4334.43 0 6529 14718 22619 33.62
hit 24.46 81.03% 14993.15 11688 21764 15007.21 13486 16565 366688 563542 34.93
crit 5.72 18.97% 30285.72 23377 43527 30281.67 0 43527 173366 266437 34.87
 
DPS Timeline Chart
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Instantly attack an enemy and two additional enemies, dealing {$s1=1} damage to the primary target and {$s3=50}% damage to the secondary targets, and generating {$/10;s2=20} Rage. Your successful dodges and parries reset the cooldown on Revenge.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.520000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shattered_bleed 410 1.8% 17.0 18.05sec 7264 0 Direct 17.0 2076 4160 2471 18.9% 2.3 623 1248 18.9%  
Periodic 96.2 796 0 796 0.0% 12.9 243 0 0.0% 32.0%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.98 16.98 96.20 96.20 0.0000 1.0000 123342.16 123342.16 0.00 1282.09 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.43 18.95% 1248.34 1165 1281 432.71 0 1281 535 535 0.00
multistrike 1.83 81.05% 622.84 582 641 521.05 0 641 1142 1142 0.00
hit 13.77 81.08% 2076.34 1941 2135 2075.99 1960 2135 28585 28585 0.00
crit 3.21 18.92% 4160.31 3882 4270 3996.31 0 4270 13364 13364 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 12.9 100.00% 242.62 243 243 242.62 243 243 3118 3118 0.00
hit 96.2 100.00% 796.20 0 809 796.57 763 809 76598 76598 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_slam 4555 20.5% 66.9 4.52sec 20449 15560 Direct 66.9 16423 33392 19661 19.1% 8.9 4924 10016 19.1%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.89 66.89 0.00 0.00 1.3142 0.0000 1367757.16 2102026.79 34.93 15560.20 15560.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.71 19.12% 10015.59 7434 13842 8181.74 0 13842 17110 26296 28.49
multistrike 7.23 80.88% 4924.34 3717 6921 4924.26 0 6921 35585 54688 34.90
hit 54.12 80.92% 16423.16 12390 23069 16441.86 15519 17967 888832 1365995 34.93
crit 12.76 19.08% 33391.51 24779 46139 33420.19 24779 43106 426230 655048 34.93
 
DPS Timeline Chart
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slam the target with your shield, causing ${$<shieldslam>} damage{$?s58375=false}[, dispelling 1 magical effect,][] and generating {$/10;s3=20} Rage. Critical strikes with Shield Slam cause your next Heroic Strike to cost no Rage and be a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.671200
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Dârkride
berserker_rage 9.1 34.46sec

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.12 9.12 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
 
blood_craze 17.8 16.18sec

Stats details: blood_craze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 17.83 0.00 51.24 51.24 0.0000 1.0000 0.00 137438.59 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.2 100.00% 0.00 0 0 0.00 0 0 0 137439 100.00
 
HPS Timeline Chart
 

Action details: blood_craze

Static Values
  • id:159362
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dârkride
  • harmful:false
  • if_expr:
Spelldata
  • id:159362
  • name:Blood Craze
  • school:physical
  • tooltip:
  • description:Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.83 83.39% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.17 16.61% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it {$?s58377=false}[and {$58377s1=2} additional nearby targets ][]for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. Generates {$/10;s2=20} Rage.
 
draenic_armor_potion 2.0 0.00sec

Stats details: draenic_armor_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156430
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156430
  • name:Draenic Armor Potion
  • school:physical
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
 
shield_charge 21.3 14.53sec

Stats details: shield_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shield_charge

Static Values
  • id:156321
  • school:physical
  • resource:rage
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
Spelldata
  • id:156321
  • name:Shield Charge
  • school:physical
  • tooltip:
  • description:Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserker_rage 9.1 0.0 34.9sec 34.5sec 18.03% 18.04% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:18.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
blood_craze 15.0 2.8 19.3sec 16.1sec 16.58% 16.59% 2.8(2.8)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_blood_craze
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • blood_craze_1:16.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159363
  • name:Blood Craze
  • tooltip:Regenerating $w1 health every $t1 sec.
  • description:{$@spelldesc159362=Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
bloodbath 5.5 0.0 60.1sec 60.0sec 21.56% 21.64% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodbath_1:21.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks and their multistrikes cause an additional {$12292s1=30}% bleed damage.
  • description:For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_armor_potion 2.0 0.0 59.9sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_draenic_armor_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:bonus_armor
  • amount:1500.00

Stack Uptimes

  • draenic_armor_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156430
  • name:Draenic Armor Potion
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enrage 17.8 27.0 17.3sec 6.8sec 76.76% 69.82% 27.0(27.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:76.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Damage dealt increased by {$s2=10}%.$?$w5!=0[ Movement speed increased by $w5%.][]
  • description:{$@spelldesc13046={$?s23881=false}[Bloodthirst critical strikes][Shield Slam and Devastate critical strikes, critical blocks,] and activating Berserker Rage will Enrage you, generating ${$12880m1/10} Rage and increasing damage done by {$12880s2=10}% for {$12880d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
enraged_speed (enraged_speed) 17.8 27.0 17.3sec 6.8sec 76.76% 76.76% 27.0(27.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enraged_speed
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enraged_speed_1:76.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58355
  • name:Glyph of Enraged Speed
  • tooltip:
  • description:While Enraged, you move {$58355s1=20}% faster.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shield_charge 21.3 0.0 14.4sec 14.5sec 49.11% 57.07% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_shield_charge
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shield_charge_1:49.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169667
  • name:Shield Charge
  • tooltip:Increases damage done by your Shield Slam, Revenge, and Heroic Strike abilities by {$s1=25}%.
  • description:{$@spelldesc156321=Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.76% 19.77% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
sword_and_board 36.2 0.0 8.1sec 8.1sec 15.71% 53.82% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_sword_and_board
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • sword_and_board_1:15.71%

Trigger Attempt Success

  • trigger_pct:30.04%

Spelldata details

  • id:50227
  • name:Sword and Board
  • tooltip:Shield Slam generates $/10;50227s1 more Rage.
  • description:Your Devastate has a {$s1=50}% chance of resetting the cooldown of your Shield Slam and increasing the Rage it generates by $/10;50227s1 for {$50227d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
ultimatum 12.8 0.0 22.6sec 22.7sec 2.81% 2.83% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_ultimatum
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ultimatum_1:2.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:122510
  • name:Ultimatum
  • tooltip:Your next Heroic Strike costs no Rage and is a critical strike.
  • description:{$@spelldesc122509=Your Shield Slam criticals make your next Heroic Strike cost no Rage and be a guaranteed critical strike.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
unyielding_strikes 16.6 81.2 18.4sec 3.1sec 92.86% 91.83% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_unyielding_strikes
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-5.00

Stack Uptimes

  • unyielding_strikes_1:13.47%
  • unyielding_strikes_2:13.24%
  • unyielding_strikes_3:12.54%
  • unyielding_strikes_4:13.49%
  • unyielding_strikes_5:13.82%
  • unyielding_strikes_6:26.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169686
  • name:Unyielding Strikes
  • tooltip:Heroic Strike cost reduced by ${$m1/-10}.
  • description:
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
gladiator_stance

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_gladiator_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • gladiator_stance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156291
  • name:Gladiator Stance
  • tooltip:An offensive stance that trades all defensive prowess for increase damage dealing. Physical damage dealt increased by {$s1=20}%. Your Shield Block is replaced with Shield Charge.
  • description:A dauntless combat stance. Increases physical damage dealt by {$s1=20}%, and replaces your Shield Block with Shield Charge. You cannot change into or out of this stance during combat.
  • max_stacks:0
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
resolve

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_resolve
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • resolve_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Custom Section

Dârkride

Overall DPS

22243.39

Percentage of damage dealt to primary target

%100.00

Dps done to primary target

22243.39

DPS occuring inside of shield charge + benefiting from shield charge

6835.28

Percentage of overall damage

30.73

Resources

Resource Usage Type Count Total Average RPE APR
Dârkride
execute Rage 6.6 199.2 30.0 30.0 1043.9
heroic_strike Rage 187.0 1941.5 10.4 10.4 626.4
shield_charge Rage 21.3 425.1 20.0 20.0 0.0
Resource Gains Type Count Total Average Overflow
blood_craze Health 51.24 0.00 (0.00%) 0.00 137444.85 100.00%
external_healing Health 8.62 0.00 (0.00%) 0.00 80073.88 100.00%
charge Rage 1.00 35.00 (1.35%) 35.00 0.00 0.00%
enrage Rage 44.84 447.11 (17.23%) 9.97 1.30 0.29%
revenge Rage 30.18 599.84 (23.11%) 19.87 3.79 0.63%
shield_slam Rage 66.89 1335.16 (51.44%) 19.96 2.55 0.19%
sword_and_board Rage 36.05 178.43 (6.87%) 4.95 1.84 1.02%
Resource RPS-Gain RPS-Loss
Rage 8.62 8.53
Combat End Resource Mean Min Max
Rage 29.25 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.7%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Dârkride Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Dârkride Damage Per Second
Count 25000
Mean 22243.39
Minimum 20088.43
Maximum 24839.69
Spread ( max - min ) 4751.26
Range [ ( max - min ) / 2 * 100% ] 10.68%
Standard Deviation 633.4184
5th Percentile 21250.62
95th Percentile 23326.03
( 95th Percentile - 5th Percentile ) 2075.41
Mean Distribution
Standard Deviation 4.0061
95.00% Confidence Intervall ( 22235.53 - 22251.24 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3115
0.1 Scale Factor Error with Delta=300 3425
0.05 Scale Factor Error with Delta=300 13700
0.01 Scale Factor Error with Delta=300 342503
Distribution Chart
DPS(e)
Sample Data Dârkride Damage Per Second (Effective)
Count 25000
Mean 22243.39
Minimum 20088.43
Maximum 24839.69
Spread ( max - min ) 4751.26
Range [ ( max - min ) / 2 * 100% ] 10.68%
Damage
Sample Data Dârkride Damage
Count 25000
Mean 6681326.71
Minimum 4903657.63
Maximum 8464575.64
Spread ( max - min ) 3560918.02
Range [ ( max - min ) / 2 * 100% ] 26.65%
DTPS
Sample Data Dârkride Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Dârkride Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Dârkride Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Dârkride Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Dârkride Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Dârkride Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data DârkrideTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Dârkride Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 stance,choose=gladiator
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists) talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done. # Generic on-use trinket line if needed when swapping trinkets out. #actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
4 0.00 potion,name=draenic_armor
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 0.00 call_action_list,name=movement,if=movement.distance>5
This is mostly to prevent cooldowns from being accidentally used during movement.
8 0.00 avatar
9 5.52 bloodbath
A 0.00 blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
B 0.00 berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
C 0.00 arcane_torrent,if=rage<rage.max-40
D 1.00 potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
E 21.26 shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
F 9.12 berserker_rage,if=buff.enrage.down
G 6.87 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
H 146.34 heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
I 40.68 heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
J 0.00 call_action_list,name=single,if=active_enemies=1
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
actions.single
# count action,conditions
P 19.70 devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Q 66.89 shield_slam
R 30.18 revenge
S 0.00 execute,if=buff.sudden_death.react
T 0.00 storm_bolt
U 5.37 dragon_roar
V 6.64 execute,if=rage>60&target.health.pct<20
W 101.04 devastate

Sample Sequence

014569EFQHRHUWWQHHWGWWIIQHRHWHWEHQHWHWHWHQHWRHWEQHWHQHHWHQHWHQHRHWHWEHQHWHWWHQHWHRHWIIQHWHWHWEHQHWFRHWQHGWQHWQHHR9DHPHWEHQHUHWHWHQRHPQHHWEHQHWHWRHFHQHPHQHWHWWHHQHRPHWEQHHWWHHWHQHRGHWWHEQWHQHWHRHWQHWHHWHWHQ9HRWHHWEQHUPWHQHHRPHIWIQFHWEHQHWHRHWQHWWGWHIQHRHPEHQHWHQHWHWQHHRHPWHEQHHWQHHWHQHRHWQIWHWHQH9WEHQHHRHPHQHUFPHIQHWGHQHRHWIWEHQHWWWQHHRPIIWIQHWHWWEQHRHPFQHHWWWIIQHRHPHWEHQHWHWWHQHRGPQH9HWEHQWIIWIRIQFIUVWQIVPEQIRIPVQPQIIVPIIQIRIPIVEIQIWWFWQRIGPIVEQIPWIIWIQIRIVIWQIWWI9QI

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 0.0/100: 0% rage
Pre food Fluffy_Pillow 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 charge Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 auto_attack Fluffy_Pillow 35.0/100: 35% rage draenic_armor_potion
0:00.000 bloodbath Fluffy_Pillow 35.0/100: 35% rage draenic_armor_potion
0:00.000 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, draenic_armor_potion
0:00.000 berserker_rage Fluffy_Pillow 15.0/100: 15% rage bloodbath, shield_charge, draenic_armor_potion
0:00.000 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, draenic_armor_potion
0:00.000 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, draenic_armor_potion
0:01.366 revenge Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, draenic_armor_potion
0:01.366 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:02.416 dragon_roar Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:03.466 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:04.515 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:05.566 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:05.566 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.616 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.616 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:07.667 heroic_leap Fluffy_Pillow 15.0/100: 15% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:07.667 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:08.718 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:08.718 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:09.770 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:09.770 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:10.821 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), ultimatum, spirit_of_the_warlords, draenic_armor_potion
0:10.821 revenge Fluffy_Pillow 35.0/100: 35% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.872 heroic_strike Fluffy_Pillow 55.0/100: 55% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.872 devastate Fluffy_Pillow 50.0/100: 50% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:12.922 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:12.922 devastate Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.973 shield_charge Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.973 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.973 shield_slam Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.025 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.025 devastate Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.075 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.075 devastate Fluffy_Pillow 70.0/100: 70% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:17.125 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodlust, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:17.125 devastate Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:18.174 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:18.174 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:19.225 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:19.225 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:20.275 revenge Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
0:20.275 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
0:21.325 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, unyielding_strikes(2), spirit_of_the_warlords
0:21.325 shield_charge Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3), spirit_of_the_warlords
0:22.374 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
0:22.374 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:23.423 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:23.423 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
0:24.473 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
0:24.473 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:25.524 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:25.524 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:26.575 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
0:26.575 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
0:27.626 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(5), ultimatum
0:27.626 devastate Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(5)
0:28.678 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
0:28.678 shield_slam Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
0:29.728 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:29.728 revenge Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:30.779 heroic_strike Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:30.779 devastate Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:31.828 heroic_strike Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:31.828 devastate Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:32.880 shield_charge Fluffy_Pillow 90.0/100: 90% rage bloodlust, enrage, enraged_speed
0:32.880 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodlust, enrage, enraged_speed, shield_charge
0:32.880 shield_slam Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge
0:33.930 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, shield_charge
0:33.930 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, shield_charge
0:34.980 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes
0:34.980 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes
0:36.030 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:36.030 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
0:37.080 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
0:37.080 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:38.130 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:38.130 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:39.179 revenge Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:39.179 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:40.231 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:40.231 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, unyielding_strikes(5)
0:41.281 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, unyielding_strikes(5)
0:41.281 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, unyielding_strikes(5)
0:42.645 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(5), ultimatum
0:42.645 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(5)
0:44.009 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
0:44.009 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
0:45.373 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
0:45.373 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
0:45.373 shield_charge Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:46.736 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:46.736 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:48.100 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge
0:48.100 devastate Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge
0:49.463 berserker_rage Fluffy_Pillow 5.0/100: 5% rage blood_craze, shield_charge, unyielding_strikes
0:49.463 revenge Fluffy_Pillow 15.0/100: 15% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
0:49.463 heroic_strike Fluffy_Pillow 10.0/100: 10% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
0:50.827 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
0:52.192 shield_slam Fluffy_Pillow 10.0/100: 10% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
0:52.192 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:53.556 heroic_leap Fluffy_Pillow 15.0/100: 15% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(2)
0:53.556 devastate Fluffy_Pillow 15.0/100: 15% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(2)
0:54.921 shield_slam Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
0:54.921 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
0:56.285 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(3)
0:57.649 shield_slam Fluffy_Pillow 25.0/100: 25% rage sword_and_board, unyielding_strikes(4)
0:57.649 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(4)
0:59.013 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(4)
0:59.013 revenge Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(4)
1:00.379 bloodbath Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(4)
1:00.379 potion Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4)
1:00.379 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:00.379 devastate Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:01.742 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(5), draenic_armor_potion
1:01.742 devastate Fluffy_Pillow 55.0/100: 55% rage bloodbath, enrage, enraged_speed, unyielding_strikes(5), draenic_armor_potion
1:01.742 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:03.106 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:03.106 shield_slam Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:04.470 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:04.470 dragon_roar Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:05.834 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:05.834 devastate Fluffy_Pillow 60.0/100: 60% rage bloodbath, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:07.198 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, shield_charge, draenic_armor_potion
1:07.198 devastate Fluffy_Pillow 30.0/100: 30% rage bloodbath, shield_charge, draenic_armor_potion
1:08.561 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodbath, shield_charge, unyielding_strikes, draenic_armor_potion
1:08.561 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, shield_charge, unyielding_strikes, draenic_armor_potion
1:09.924 revenge Fluffy_Pillow 25.0/100: 25% rage bloodbath, unyielding_strikes, draenic_armor_potion
1:09.924 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, unyielding_strikes, draenic_armor_potion
1:11.290 devastate Fluffy_Pillow 20.0/100: 20% rage bloodbath, unyielding_strikes, draenic_armor_potion
1:12.654 shield_slam Fluffy_Pillow 20.0/100: 20% rage sword_and_board, unyielding_strikes(2), draenic_armor_potion
1:12.654 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(2), draenic_armor_potion
1:14.018 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(2), draenic_armor_potion
1:14.018 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2), draenic_armor_potion
1:15.018 shield_charge Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3), draenic_armor_potion
1:15.384 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3), draenic_armor_potion
1:15.384 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3), draenic_armor_potion
1:16.749 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3), draenic_armor_potion
1:16.749 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3), draenic_armor_potion
1:18.113 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4), draenic_armor_potion
1:18.113 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4), draenic_armor_potion
1:19.478 revenge Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:19.478 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:20.845 berserker_rage Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(5), draenic_armor_potion
1:20.845 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:20.845 shield_slam Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:22.210 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5), draenic_armor_potion
1:22.210 devastate Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5), draenic_armor_potion
1:23.574 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:23.574 shield_slam Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:24.938 heroic_strike Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:24.938 devastate Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:26.303 heroic_strike Fluffy_Pillow 70.0/100: 70% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
1:26.303 devastate Fluffy_Pillow 70.0/100: 70% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
1:27.669 devastate Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed
1:27.669 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, sword_and_board, unyielding_strikes
1:29.032 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, sword_and_board, unyielding_strikes
1:29.032 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes
1:30.398 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes
1:30.398 revenge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes
1:31.762 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes
1:31.762 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(2)
1:33.126 devastate Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(2)
1:34.490 shield_charge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(3)
1:34.490 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:34.490 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:35.854 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:35.854 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:37.220 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
1:37.220 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:38.584 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:38.584 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:39.949 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
1:39.949 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
1:41.314 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:41.314 revenge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:42.680 heroic_leap Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
1:42.680 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
1:42.680 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
1:44.044 devastate Fluffy_Pillow 45.0/100: 45% rage blood_craze, enrage, enraged_speed
1:44.044 heroic_strike Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes
1:45.408 shield_charge Fluffy_Pillow 20.0/100: 20% rage blood_craze, unyielding_strikes
1:45.408 shield_slam Fluffy_Pillow 0.0/100: 0% rage blood_craze, shield_charge, unyielding_strikes
1:46.772 devastate Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes
1:46.772 heroic_strike Fluffy_Pillow 0.0/100: 0% rage shield_charge, sword_and_board, unyielding_strikes(2)
1:48.137 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, sword_and_board, unyielding_strikes(2)
1:48.137 heroic_strike Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(2)
1:49.500 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(2)
1:49.500 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:50.864 revenge Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:50.864 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:52.228 devastate Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:53.593 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(4)
1:53.593 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
1:54.958 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
1:54.958 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(5)
1:56.322 heroic_strike Fluffy_Pillow 25.0/100: 25% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
1:56.322 devastate Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
1:57.685 heroic_strike Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(6)
1:57.685 devastate Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(6)
1:59.051 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
1:59.051 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
2:00.414 bloodbath Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
2:00.414 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
2:00.414 revenge Fluffy_Pillow 45.0/100: 45% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6)
2:01.777 devastate Fluffy_Pillow 65.0/100: 65% rage bloodbath, enrage, enraged_speed
2:01.777 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes
2:03.142 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes
2:03.142 devastate Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, unyielding_strikes
2:04.506 shield_charge Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, unyielding_strikes(2), spirit_of_the_warlords
2:04.506 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:04.506 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:05.870 dragon_roar Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:07.235 devastate Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:08.601 devastate Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
2:08.601 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:09.965 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:09.965 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:11.328 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:11.328 revenge Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:12.695 devastate Fluffy_Pillow 25.0/100: 25% rage blood_craze, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
2:12.695 heroic_strike Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
2:14.059 heroic_strike Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
2:14.059 devastate Fluffy_Pillow 15.0/100: 15% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
2:15.423 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
2:15.423 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
2:16.786 berserker_rage Fluffy_Pillow 40.0/100: 40% rage blood_craze, unyielding_strikes(6), spirit_of_the_warlords
2:16.786 heroic_strike Fluffy_Pillow 50.0/100: 50% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:16.786 devastate Fluffy_Pillow 50.0/100: 50% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:16.786 shield_charge Fluffy_Pillow 40.0/100: 40% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
2:18.152 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
2:18.152 shield_slam Fluffy_Pillow 40.0/100: 40% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
2:19.515 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, enrage, enraged_speed, shield_charge, spirit_of_the_warlords
2:19.515 devastate Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, shield_charge, spirit_of_the_warlords
2:20.879 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:20.879 revenge Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:22.243 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:22.243 devastate Fluffy_Pillow 5.0/100: 5% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:23.609 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:23.609 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:24.974 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(2)
2:26.336 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(3)
2:27.701 heroic_leap Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(4)
2:27.701 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(4)
2:27.701 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
2:29.066 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
2:29.066 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
2:30.430 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(5)
2:30.430 revenge Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(5)
2:31.793 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(5)
2:31.793 devastate Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(5)
2:31.793 shield_charge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:33.158 heroic_strike Fluffy_Pillow 30.0/100: 30% rage shield_charge, sword_and_board, unyielding_strikes(6)
2:33.158 shield_slam Fluffy_Pillow 30.0/100: 30% rage shield_charge, sword_and_board, unyielding_strikes(6)
2:34.522 heroic_strike Fluffy_Pillow 55.0/100: 55% rage shield_charge, unyielding_strikes(6)
2:34.522 devastate Fluffy_Pillow 55.0/100: 55% rage shield_charge, unyielding_strikes(6)
2:35.887 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:35.887 shield_slam Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:37.252 heroic_strike Fluffy_Pillow 90.0/100: 90% rage enrage, enraged_speed, shield_charge
2:37.252 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge
2:38.617 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, unyielding_strikes
2:38.617 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes
2:39.982 shield_slam Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(2)
2:39.982 heroic_strike Fluffy_Pillow 40.0/100: 40% rage blood_craze, enrage, enraged_speed, unyielding_strikes(2)
2:41.347 heroic_strike Fluffy_Pillow 40.0/100: 40% rage blood_craze, enrage, enraged_speed, unyielding_strikes(2)
2:41.347 revenge Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(2)
2:42.711 heroic_strike Fluffy_Pillow 40.0/100: 40% rage blood_craze, unyielding_strikes(2)
2:42.711 devastate Fluffy_Pillow 20.0/100: 20% rage blood_craze, unyielding_strikes(2)
2:44.075 devastate Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(3)
2:44.075 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
2:45.439 shield_charge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
2:45.439 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:45.439 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:46.804 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:46.804 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:48.169 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
2:48.169 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:49.535 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:49.535 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:50.899 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:50.899 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
2:52.265 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), ultimatum
2:52.265 revenge Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:53.628 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(6)
2:53.628 devastate Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(6)
2:54.993 shield_slam Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, sword_and_board
2:54.993 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed
2:56.356 devastate Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed
2:56.356 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes
2:57.721 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes
2:57.721 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(2)
2:59.084 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(2)
2:59.084 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
3:00.447 bloodbath Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
3:00.447 devastate Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes(2)
3:00.447 shield_charge Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
3:00.447 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
3:01.812 shield_slam Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
3:01.812 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:03.177 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:03.177 revenge Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:04.543 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:04.543 devastate Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:05.908 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
3:05.908 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
3:07.273 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:07.273 dragon_roar Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:08.639 berserker_rage Fluffy_Pillow 15.0/100: 15% rage bloodbath, unyielding_strikes(4)
3:08.639 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(4)
3:08.639 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, bloodbath, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:10.004 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, bloodbath, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:10.004 shield_slam Fluffy_Pillow 15.0/100: 15% rage berserker_rage, bloodbath, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:11.367 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(5)
3:11.367 devastate Fluffy_Pillow 35.0/100: 35% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(5)
3:12.732 heroic_leap Fluffy_Pillow 35.0/100: 35% rage berserker_rage, blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
3:12.732 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
3:12.732 shield_slam Fluffy_Pillow 35.0/100: 35% rage berserker_rage, blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
3:14.097 heroic_strike Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:14.097 revenge Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:15.464 heroic_strike Fluffy_Pillow 80.0/100: 80% rage enrage, enraged_speed, unyielding_strikes(6)
3:15.464 devastate Fluffy_Pillow 80.0/100: 80% rage enrage, enraged_speed, unyielding_strikes(6)
3:16.829 heroic_strike Fluffy_Pillow 80.0/100: 80% rage
3:16.829 devastate Fluffy_Pillow 50.0/100: 50% rage
3:18.194 shield_charge Fluffy_Pillow 50.0/100: 50% rage unyielding_strikes
3:18.194 heroic_strike Fluffy_Pillow 30.0/100: 30% rage shield_charge, unyielding_strikes
3:18.194 shield_slam Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes
3:19.557 heroic_strike Fluffy_Pillow 25.0/100: 25% rage shield_charge, unyielding_strikes
3:19.557 devastate Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes
3:20.922 devastate Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(2)
3:22.288 devastate Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(3)
3:23.652 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(4)
3:23.652 heroic_strike Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes(4)
3:25.016 heroic_strike Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes(4)
3:25.016 revenge Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(4)
3:26.383 devastate Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(4)
3:26.383 heroic_strike Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(5)
3:27.749 heroic_strike Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(5)
3:27.749 devastate Fluffy_Pillow 10.0/100: 10% rage unyielding_strikes(5)
3:29.116 heroic_strike Fluffy_Pillow 10.0/100: 10% rage unyielding_strikes(6)
3:29.116 shield_slam Fluffy_Pillow 10.0/100: 10% rage unyielding_strikes(6)
3:30.481 heroic_strike Fluffy_Pillow 30.0/100: 30% rage blood_craze, unyielding_strikes(6)
3:30.481 devastate Fluffy_Pillow 30.0/100: 30% rage blood_craze, unyielding_strikes(6)
3:31.847 heroic_strike Fluffy_Pillow 30.0/100: 30% rage blood_craze, unyielding_strikes(6)
3:31.847 devastate Fluffy_Pillow 30.0/100: 30% rage blood_craze, unyielding_strikes(6)
3:33.211 devastate Fluffy_Pillow 30.0/100: 30% rage blood_craze
3:33.211 shield_charge Fluffy_Pillow 10.0/100: 10% rage blood_craze, shield_charge, sword_and_board, unyielding_strikes
3:34.576 shield_slam Fluffy_Pillow 10.0/100: 10% rage blood_craze, shield_charge, sword_and_board, unyielding_strikes
3:34.576 heroic_strike Fluffy_Pillow 10.0/100: 10% rage blood_craze, shield_charge, unyielding_strikes
3:35.941 revenge Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes
3:35.941 heroic_strike Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes
3:37.304 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes
3:38.668 berserker_rage Fluffy_Pillow 5.0/100: 5% rage shield_charge, sword_and_board, unyielding_strikes(2)
3:38.668 shield_slam Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
3:38.668 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:40.032 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:40.032 devastate Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:41.397 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
3:42.761 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
3:42.761 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:44.125 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:44.125 shield_slam Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:45.489 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(5)
3:45.489 revenge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(5)
3:46.852 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(5)
3:46.852 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(5)
3:48.218 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
3:48.218 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
3:48.218 shield_charge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:49.583 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:49.583 shield_slam Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:50.947 heroic_strike Fluffy_Pillow 50.0/100: 50% rage shield_charge, unyielding_strikes(6)
3:50.947 devastate Fluffy_Pillow 50.0/100: 50% rage shield_charge, unyielding_strikes(6)
3:52.312 heroic_strike Fluffy_Pillow 50.0/100: 50% rage shield_charge
3:52.312 devastate Fluffy_Pillow 20.0/100: 20% rage shield_charge
3:53.676 devastate Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes
3:53.676 heroic_strike Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(2)
3:55.042 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(2)
3:55.042 heroic_strike Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(2)
3:56.407 revenge Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(2)
3:57.771 heroic_leap Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(2)
3:57.771 devastate Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(2)
3:59.136 shield_slam Fluffy_Pillow 20.0/100: 20% rage sword_and_board, unyielding_strikes(3)
3:59.136 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(3)
4:00.501 bloodbath Fluffy_Pillow 55.0/100: 55% rage blood_craze, enrage, enraged_speed, unyielding_strikes(3)
4:00.501 heroic_strike Fluffy_Pillow 55.0/100: 55% rage bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(3)
4:00.501 devastate Fluffy_Pillow 40.0/100: 40% rage bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(3)
4:00.501 shield_charge Fluffy_Pillow 20.0/100: 20% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
4:01.864 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
4:01.864 shield_slam Fluffy_Pillow 10.0/100: 10% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
4:03.229 devastate Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:03.229 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:04.593 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:04.593 devastate Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
4:05.957 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:05.957 revenge Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:07.322 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodbath, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:07.322 shield_slam Fluffy_Pillow 45.0/100: 45% rage bloodbath, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
4:08.686 berserker_rage Fluffy_Pillow 65.0/100: 65% rage bloodbath, unyielding_strikes(6), spirit_of_the_warlords
4:08.686 heroic_strike Fluffy_Pillow 75.0/100: 75% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:08.686 dragon_roar Fluffy_Pillow 75.0/100: 75% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:10.049 execute Fluffy_Pillow 75.0/100: 75% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, spirit_of_the_warlords
4:11.415 devastate Fluffy_Pillow 45.0/100: 45% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, spirit_of_the_warlords
4:12.779 shield_slam Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:12.779 heroic_strike Fluffy_Pillow 75.0/100: 75% rage berserker_rage, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:14.143 execute Fluffy_Pillow 75.0/100: 75% rage berserker_rage, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:15.508 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:15.508 shield_charge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), spirit_of_the_warlords
4:16.872 shield_slam Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), spirit_of_the_warlords
4:16.872 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:18.237 revenge Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:18.237 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:19.601 devastate Fluffy_Pillow 60.0/100: 60% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:20.966 execute Fluffy_Pillow 70.0/100: 70% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
4:22.331 shield_slam Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
4:23.694 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(3)
4:25.059 shield_slam Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(4)
4:25.059 heroic_strike Fluffy_Pillow 85.0/100: 85% rage enrage, enraged_speed, unyielding_strikes(4)
4:26.424 heroic_strike Fluffy_Pillow 85.0/100: 85% rage enrage, enraged_speed, unyielding_strikes(4)
4:26.424 execute Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, unyielding_strikes(4)
4:27.788 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(4)
4:27.788 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:29.152 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:29.152 shield_slam Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:30.516 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(5)
4:30.516 revenge Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(5)
4:31.882 heroic_strike Fluffy_Pillow 75.0/100: 75% rage unyielding_strikes(5)
4:31.882 devastate Fluffy_Pillow 70.0/100: 70% rage unyielding_strikes(5)
4:33.246 heroic_strike Fluffy_Pillow 70.0/100: 70% rage unyielding_strikes(6)
4:33.246 execute Fluffy_Pillow 70.0/100: 70% rage unyielding_strikes(6)
4:34.610 shield_charge Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(6)
4:34.610 heroic_strike Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(6)
4:34.610 shield_slam Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(6)
4:35.975 heroic_strike Fluffy_Pillow 40.0/100: 40% rage shield_charge, unyielding_strikes(6)
4:35.975 devastate Fluffy_Pillow 40.0/100: 40% rage shield_charge, unyielding_strikes(6)
4:37.340 devastate Fluffy_Pillow 40.0/100: 40% rage shield_charge
4:38.703 berserker_rage Fluffy_Pillow 40.0/100: 40% rage shield_charge, unyielding_strikes
4:38.703 devastate Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
4:40.066 shield_slam Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:41.430 revenge Fluffy_Pillow 70.0/100: 70% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:41.430 heroic_strike Fluffy_Pillow 70.0/100: 70% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:42.794 heroic_leap Fluffy_Pillow 70.0/100: 70% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(2)
4:42.794 devastate Fluffy_Pillow 70.0/100: 70% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(2)
4:42.794 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(3)
4:44.158 execute Fluffy_Pillow 65.0/100: 65% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(3)
4:45.523 shield_charge Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(3)
4:45.523 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:45.523 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:46.887 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:48.254 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:48.254 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:49.619 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:49.619 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:50.982 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:50.982 shield_slam Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:52.346 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:52.346 revenge Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:53.711 heroic_strike Fluffy_Pillow 75.0/100: 75% rage unyielding_strikes(6)
4:53.711 execute Fluffy_Pillow 75.0/100: 75% rage unyielding_strikes(6)
4:55.075 heroic_strike Fluffy_Pillow 45.0/100: 45% rage
4:55.075 devastate Fluffy_Pillow 15.0/100: 15% rage
4:56.440 shield_slam Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes
4:56.440 heroic_strike Fluffy_Pillow 10.0/100: 10% rage unyielding_strikes
4:57.805 devastate Fluffy_Pillow 10.0/100: 10% rage unyielding_strikes
4:59.169 devastate Fluffy_Pillow 10.0/100: 10% rage unyielding_strikes(2)
4:59.169 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
5:00.534 bloodbath Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
5:00.534 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
5:00.534 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, unyielding_strikes(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4129 3683 3683 (1596)
Agility 933 889 889
Stamina 4312 3920 3778
Intellect 746 711 711
Spirit 679 679 679
Health 258720 235200 0
Rage 100 100 0
Crit 19.49% 13.58% 944
Haste 10.23% 4.98% 498
Multistrike 6.68% 1.68% 111
Damage / Heal Versatility 7.83% 4.83% 628
Attack Power 5508 4351 0
Mastery 30.10% 22.24% 751
Armor 2781 2781 2675
Bonus Armor 106 106 106

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Heavy Repercussions (Protection Warrior) Sudden Death Unyielding Strikes (Protection Warrior)
60 Storm Bolt Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Bladestorm
100 Anger Management Ravager Gladiator's Resolve (Protection Warrior)

Profile

warrior="Dârkride"
origin="http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/237/36647661-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=blacksmithing=666/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Zb!1022212
glyphs=enraged_speed/cleave/bull_rush/gushing_wound/bloodcurdling_shout/mystic_shout
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=blackrock_barbecue
#
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists)
talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
actions.precombat+=/stance,choose=gladiator
# Snapshot raid buffed stats before combat begins and pre-potting is done.
# Generic on-use trinket line if needed when swapping trinkets out.
#actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_armor

# Executed every time the actor is available.

actions=charge
actions+=/auto_attack
# This is mostly to prevent cooldowns from being accidentally used during movement.
actions+=/call_action_list,name=movement,if=movement.distance>5
actions+=/avatar
actions+=/bloodbath
actions+=/blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
actions+=/shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
actions+=/berserker_rage,if=buff.enrage.down
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
actions+=/heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>=2

actions.movement=heroic_leap
actions.movement+=/shield_charge
# May as well throw storm bolt if we can.
actions.movement+=/storm_bolt
actions.movement+=/heroic_throw

actions.single=devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
actions.single+=/shield_slam
actions.single+=/revenge
actions.single+=/execute,if=buff.sudden_death.react
actions.single+=/storm_bolt
actions.single+=/dragon_roar
actions.single+=/execute,if=rage>60&target.health.pct<20
actions.single+=/devastate

actions.aoe=revenge
actions.aoe+=/shield_slam
actions.aoe+=/dragon_roar,if=(buff.bloodbath.up|cooldown.bloodbath.remains>10)|!talent.bloodbath.enabled
actions.aoe+=/storm_bolt,if=(buff.bloodbath.up|cooldown.bloodbath.remains>7)|!talent.bloodbath.enabled
actions.aoe+=/thunder_clap,cycle_targets=1,if=dot.deep_wounds.remains<3&active_enemies>4
actions.aoe+=/bladestorm,if=buff.shield_charge.down
actions.aoe+=/execute,if=buff.sudden_death.react
actions.aoe+=/thunder_clap,if=active_enemies>6
actions.aoe+=/devastate,cycle_targets=1,if=dot.deep_wounds.remains<5&cooldown.shield_slam.remains>execute_time*0.4
actions.aoe+=/devastate,if=cooldown.shield_slam.remains>execute_time*0.4

head=casque_of_the_iron_bomber,id=113600
neck=flesh_beetle_brooch,id=109968,bonus_id=524,enchant=40crit
shoulders=verdant_plate_spaulders,id=109944,bonus_id=524
back=milenahs_intricate_cloak,id=119345,enchant=100crit
chest=gutcrusher_chestplate,id=109895,bonus_id=499/523/524,gems=35crit
shirt=antisepticsoaked_dressing,id=44694
wrists=verdant_plate_wristguards,id=109877,bonus_id=523/524,gems=35crit
hands=gauntlets_of_the_heavy_hand,id=113632,bonus_id=563,gems=35crit
waist=ripswallow_plate_belt,id=119337,bonus_id=560
legs=truesteel_greaves,id=114234,bonus_id=94/525/533
feet=entrail_squishers,id=113633
finger1=timeless_solium_band_of_the_bulwark,id=118298
finger2=knucklebone_of_lodronar,id=109772,bonus_id=524,enchant=30mastery
trinket1=mote_of_corruption,id=110010,bonus_id=524
trinket2=skull_of_war,id=112318,bonus_id=525/529
main_hand=tharbeks_brutal_posessor,id=118726,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=ogre_dinner_plate,id=110044,bonus_id=524

# Gear Summary
# gear_strength=2228
# gear_stamina=2844
# gear_crit_rating=944
# gear_haste_rating=498
# gear_mastery_rating=715
# gear_armor=2675
# gear_bonus_armor=106
# gear_multistrike_rating=111
# gear_versatility_rating=528

Simulation & Raid Information

Iterations: 25004
Threads: 4
Confidence: 95.00%
Fight Length: 228 - 375 ( 301.0 )

Performance:

Total Events Processed: 1025081213
Max Event Queue: 374
Sim Seconds: 7525042
CPU Seconds: 672.5190
Physical Seconds: 672.5190
Speed Up: 11189

Settings:

World Lag: 50 ms ( stddev = 5 ms )
Queue Lag: 5 ms ( stddev = 1 ms )
Simulation Length
Sample Data Simulation Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
Standard Deviation 39.4047
5th Percentile 241.71
95th Percentile 363.05
( 95th Percentile - 5th Percentile ) 121.34
Mean Distribution
Standard Deviation 0.2492
95.00% Confidence Intervall ( 300.47 - 301.44 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 658
0.1% Error 65855
0.1 Scale Factor Error with Delta=300 13
0.05 Scale Factor Error with Delta=300 53
0.01 Scale Factor Error with Delta=300 1325
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Ciaran Ciaran celestial_alignment 112071 0 0 0.40 0 0 2.0 2.0 13.2% 0.0% 0.0% 0.0% 181.80sec 0 300.95sec
Ciaran Ciaran draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Ciaran Ciaran force_of_nature 33831 0 0 3.35 0 0 16.8 16.8 12.6% 0.0% 0.0% 0.0% 19.73sec 0 300.95sec
Ciaran Ciaran moonfire 8921 51455 171 1.80 4790 9173 9.0 9.0 12.7% 0.0% 0.0% 0.0% 35.00sec 758744 300.95sec
Ciaran Ciaran moonfire ticks -8921 707290 2358 35.14 3324 6748 9.0 175.7 12.9% 0.0% 0.0% 0.0% 35.00sec 758744 300.95sec
Ciaran Ciaran moonkin_form 24858 0 0 0.20 0 0 1.0 1.0 10.5% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Ciaran Ciaran shattered_bleed 159238 33938 113 3.47 1616 3249 17.4 17.4 12.7% 0.0% 0.0% 0.0% 17.57sec 115441 300.95sec
Ciaran Ciaran shattered_bleed ticks -159238 81503 272 19.45 783 0 17.4 97.2 0.0% 0.0% 0.0% 0.0% 17.57sec 115441 300.95sec
Ciaran Ciaran starfire 2912 2032044 6752 10.50 31712 65099 52.7 52.7 13.1% 0.0% 0.0% 0.0% 5.60sec 2032044 300.95sec
Ciaran Ciaran starsurge 78674 1185468 3939 6.09 31951 65312 30.7 30.5 13.1% 0.0% 0.0% 0.0% 10.03sec 1185468 300.95sec
Ciaran Ciaran sunfire 93402 80782 268 1.90 7030 14202 9.5 9.5 12.5% 0.0% 0.0% 0.0% 32.37sec 706215 300.95sec
Ciaran Ciaran sunfire ticks -93402 625433 2085 33.84 3050 6227 9.5 169.2 12.9% 0.0% 0.0% 0.0% 32.37sec 706215 300.95sec
Ciaran Ciaran wrath 5176 1231220 4091 12.21 16754 33546 61.6 61.3 12.2% 0.0% 0.0% 0.0% 4.27sec 1231220 300.95sec
Ciaran Ciaran_treant wrath 113769 44517 206 28.30 362 728 102.3 101.8 12.8% 0.0% 0.0% 0.0% 3.12sec 44517 215.96sec
Kernoris Kernoris berserk 106952 0 0 0.40 0 0 2.0 2.0 29.2% 0.0% 0.0% 0.0% 183.28sec 0 300.95sec
Kernoris Kernoris cat_form 768 0 0 0.20 0 0 1.0 1.0 29.4% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Kernoris Kernoris cat_melee 0 1546981 5140 70.84 3222 6442 355.3 355.3 29.1% 0.0% 0.0% 0.0% 0.85sec 2377465 300.95sec
Kernoris Kernoris draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Kernoris Kernoris ferocious_bite 22568 1065489 3540 2.82 45512 91019 14.1 14.1 58.2% 0.0% 0.0% 0.0% 21.47sec 1637488 300.95sec
Kernoris Kernoris healing_touch 5185 0 0 5.82 0 0 29.2 29.2 32.2% 0.0% 0.0% 0.0% 10.52sec 955816 300.95sec
Kernoris Kernoris leader_of_the_pack 68285 0 0 7.98 0 0 40.0 40.0 0.0% 0.0% 0.0% 0.0% 7.60sec 329797 300.95sec
Kernoris Kernoris rake 1822 197963 658 4.63 6306 12610 23.2 23.2 29.2% 0.0% 0.0% 0.0% 13.07sec 1058266 300.95sec
Kernoris Kernoris rake ticks -1822 860303 2868 19.79 6427 12844 23.2 99.0 29.1% 0.0% 0.0% 0.0% 13.07sec 1058266 300.95sec
Kernoris Kernoris rip ticks -1079 1257011 4190 28.62 6500 12997 9.3 143.1 29.2% 0.0% 0.0% 0.0% 24.98sec 1257011 300.95sec
Kernoris Kernoris savage_roar 52610 0 0 1.53 0 0 7.7 7.7 0.0% 0.0% 0.0% 0.0% 37.66sec 0 300.95sec
Kernoris Kernoris shattered_bleed 159238 54436 181 3.48 2303 4607 17.5 17.5 29.2% 0.0% 0.0% 0.0% 17.49sec 171173 300.95sec
Kernoris Kernoris shattered_bleed ticks -159238 116737 389 19.64 1135 0 17.5 98.2 0.0% 0.0% 0.0% 0.0% 17.49sec 171173 300.95sec
Kernoris Kernoris shred 5221 1233067 4097 19.65 9250 18505 98.6 98.6 29.2% 0.0% 0.0% 0.0% 3.05sec 1895029 300.95sec
Kernoris Kernoris thrash_cat 106830 15346 51 0.49 4592 9186 2.5 2.5 29.2% 0.0% 0.0% 0.0% 60.91sec 69358 300.95sec
Kernoris Kernoris thrash_cat ticks -106830 54012 180 2.43 3282 6565 2.5 12.2 29.2% 0.0% 0.0% 0.0% 60.91sec 69358 300.95sec
Kernoris Kernoris tigers_fury 5217 0 0 2.04 0 0 10.2 10.2 29.1% 0.0% 0.0% 0.0% 30.54sec 0 300.95sec
Rapáx Rapáx a_murder_of_crows 131894 0 0 1.04 0 0 5.2 5.2 0.0% 0.0% 0.0% 0.0% 63.33sec 0 300.95sec
Rapáx Rapáx crow_peck 131900 470891 1565 15.20 4118 8425 0.0 76.3 38.9% 0.0% 0.0% 0.0% 0.00sec 723685 300.95sec
Rapáx Rapáx arcane_shot 3044 995814 3309 17.41 7737 15616 87.7 87.3 35.9% 0.0% 0.0% 0.0% 3.40sec 995814 300.95sec
Rapáx Rapáx auto_shot 0 573620 1906 21.21 3652 7380 106.4 106.4 36.0% 0.0% 0.0% 0.0% 2.84sec 881563 300.95sec
Rapáx Rapáx barrage ticks -120360 646739 2156 35.29 2389 4836 11.0 176.5 36.1% 0.0% 0.0% 0.0% 27.21sec 955977 300.95sec
Rapáx Rapáx black_arrow ticks -3674 760133 2534 23.47 4381 8876 12.2 117.3 36.0% 0.0% 0.0% 0.0% 25.79sec 760133 300.95sec
Rapáx Rapáx draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Rapáx Rapáx explosive_shot 53301 357889 1189 14.69 3287 6655 73.9 73.7 36.0% 0.0% 0.0% 0.0% 4.07sec 1423194 300.95sec
Rapáx Rapáx explosive_shot ticks -53301 1065305 3551 33.81 4262 8626 73.9 169.0 36.1% 0.0% 0.0% 0.0% 4.07sec 1423194 300.95sec
Rapáx Rapáx focusing_shot 152245 371805 1235 8.48 5939 11979 42.5 42.5 35.8% 0.0% 0.0% 0.0% 6.98sec 571405 300.95sec
Rapáx Rapáx serpent_sting ticks -118253 1175571 3919 37.13 4293 8681 87.3 185.7 35.8% 0.0% 0.0% 0.0% 3.40sec 1175571 300.95sec
Rapáx Rapáx summon_pet 0 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Rapáx Rapáx_cat claw 16827 218744 727 14.50 1905 3886 72.7 72.7 46.2% 0.0% 0.0% 0.0% 4.18sec 336175 300.95sec
Rapáx Rapáx_cat melee 0 530664 1763 39.06 1725 3493 195.9 195.9 46.1% 0.0% 0.0% 0.0% 1.53sec 815547 300.95sec
Rosalîîe Rosalîîe a_murder_of_crows 131894 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 62.17sec 0 300.95sec
Rosalîîe Rosalîîe crow_peck 131900 500863 1664 15.44 4432 8863 0.0 77.5 27.9% 0.0% 0.0% 0.0% 0.00sec 769747 300.95sec
Rosalîîe Rosalîîe arcane_shot 3044 660571 2195 8.38 10570 21143 42.3 42.0 28.0% 0.0% 0.0% 0.0% 7.13sec 660571 300.95sec
Rosalîîe Rosalîîe auto_shot 0 779338 2590 21.64 4836 9672 108.6 108.6 28.0% 0.0% 0.0% 0.0% 2.79sec 1197719 300.95sec
Rosalîîe Rosalîîe barrage ticks -120360 726249 2421 36.98 2491 4982 11.6 184.9 28.0% 0.0% 0.0% 0.0% 25.63sec 1042053 300.95sec
Rosalîîe Rosalîîe black_arrow ticks -3674 1103442 3678 24.02 6189 12379 12.4 120.1 28.0% 0.0% 0.0% 0.0% 25.15sec 1103442 300.95sec
Rosalîîe Rosalîîe cobra_shot 77767 731904 2432 15.59 6319 12638 78.4 78.2 28.0% 0.0% 0.0% 0.0% 3.76sec 731904 300.95sec
Rosalîîe Rosalîîe draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Rosalîîe Rosalîîe explosive_shot 53301 509093 1692 14.70 4645 9289 74.0 73.7 28.0% 0.0% 0.0% 0.0% 4.07sec 2020273 300.95sec
Rosalîîe Rosalîîe explosive_shot ticks -53301 1511180 5037 33.34 6111 12217 74.0 166.7 28.0% 0.0% 0.0% 0.0% 4.07sec 2020273 300.95sec
Rosalîîe Rosalîîe serpent_sting ticks -118253 960355 3201 27.97 4626 9251 42.0 139.9 28.0% 0.0% 0.0% 0.0% 7.15sec 960355 300.95sec
Procrank Procrank draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Procrank Procrank frostbolt 116 1325632 4405 20.09 9163 18477 101.0 100.8 13.7% 0.0% 0.0% 0.0% 2.95sec 1325632 300.95sec
Procrank Procrank icicle_fb 148022 535836 1780 36.48 2929 0 184.1 183.0 0.0% 0.0% 0.0% 0.0% 1.97sec 535836 300.95sec
Procrank Procrank frostfire_bolt 44614 1076695 3578 6.22 15452 31215 31.3 31.2 71.1% 0.0% 0.0% 0.0% 9.34sec 1076695 300.95sec
Procrank Procrank icicle_ffb 148022 396361 1317 11.96 6607 0 60.3 60.0 0.0% 0.0% 0.0% 0.0% 5.10sec 396361 300.95sec
Procrank Procrank frozen_orb 84714 0 0 1.09 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 60.85sec 0 300.95sec
Procrank Procrank frozen_orb_bolt 84721 254342 845 10.64 3111 6210 0.0 53.4 16.6% 0.0% 0.0% 0.0% 0.00sec 254342 300.95sec
Procrank Procrank ice_lance 30455 1366931 4542 9.78 12534 25223 49.2 49.1 72.1% 0.0% 0.0% 0.0% 6.08sec 1366931 300.95sec
Procrank Procrank ice_nova 157997 643775 2139 2.68 31931 64112 13.4 13.4 14.2% 0.0% 0.0% 0.0% 23.09sec 643775 300.95sec
Procrank Procrank icy_veins 12472 0 0 0.41 0 0 2.1 2.1 12.9% 0.0% 0.0% 0.0% 181.36sec 0 300.95sec
Procrank Procrank mirror_image 55342 0 0 0.60 0 0 3.0 3.0 13.9% 0.0% 0.0% 0.0% 120.68sec 0 300.95sec
Procrank Procrank_mirror_image frostbolt 59638 1065888 9537 107.84 3443 6988 201.9 200.9 17.8% 0.0% 0.0% 0.0% 4.07sec 1065888 111.76sec
Procrank Procrank shattered_bleed 159238 38441 128 3.37 1584 3169 16.9 16.9 13.9% 0.0% 0.0% 0.0% 18.20sec 134038 300.95sec
Procrank Procrank shattered_bleed ticks -159238 95598 319 19.10 785 0 16.9 95.5 0.0% 0.0% 0.0% 0.0% 18.20sec 134038 300.95sec
Procrank Procrank water_elemental 31687 0 0 0.20 0 0 1.0 1.0 11.6% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Procrank Procrank_water_elemental water_jet ticks -135029 131210 437 7.96 2261 4567 10.0 39.8 14.7% 0.0% 0.0% 0.0% 30.28sec 131210 300.95sec
Procrank Procrank_water_elemental waterbolt 31707 627252 2084 22.31 3849 7759 112.8 111.9 13.9% 0.0% 0.0% 0.0% 2.65sec 627252 300.95sec
Zentimeter Zentimeter draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Zentimeter Zentimeter frostbolt 116 1221085 4057 20.99 8482 17134 105.5 105.3 11.5% 0.0% 0.0% 0.0% 2.82sec 1221085 300.95sec
Zentimeter Zentimeter icicle_fb 148022 575006 1911 35.55 3225 0 179.4 178.3 0.0% 0.0% 0.0% 0.0% 1.97sec 575006 300.95sec
Zentimeter Zentimeter frostfire_bolt 44614 898876 2987 5.85 14335 28971 29.4 29.3 68.0% 0.0% 0.0% 0.0% 9.92sec 898876 300.95sec
Zentimeter Zentimeter icicle_ffb 148022 393359 1307 10.61 7395 0 53.4 53.2 0.0% 0.0% 0.0% 0.0% 5.70sec 393359 300.95sec
Zentimeter Zentimeter frozen_orb 84714 0 0 1.08 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 60.94sec 0 300.95sec
Zentimeter Zentimeter frozen_orb_bolt 84721 225213 748 10.63 2889 5767 0.0 53.3 14.5% 0.0% 0.0% 0.0% 0.00sec 225213 300.95sec
Zentimeter Zentimeter ice_lance 30455 1220457 4055 9.89 11623 23388 49.7 49.6 68.8% 0.0% 0.0% 0.0% 6.02sec 1220457 300.95sec
Zentimeter Zentimeter ice_nova 157997 569649 1893 2.68 29625 59511 13.4 13.4 12.1% 0.0% 0.0% 0.0% 23.09sec 569649 300.95sec
Zentimeter Zentimeter icy_veins 12472 0 0 0.41 0 0 2.1 2.1 10.5% 0.0% 0.0% 0.0% 180.96sec 0 300.95sec
Zentimeter Zentimeter mirror_image 55342 0 0 0.60 0 0 3.0 3.0 11.9% 0.0% 0.0% 0.0% 120.92sec 0 300.95sec
Zentimeter Zentimeter_mirror_image frostbolt 59638 945131 8464 107.97 3190 6489 201.9 201.0 15.7% 0.0% 0.0% 0.0% 4.06sec 945131 111.67sec
Zentimeter Zentimeter shattered_bleed 159238 37033 123 3.43 1571 3143 17.2 17.2 11.8% 0.0% 0.0% 0.0% 17.82sec 130677 300.95sec
Zentimeter Zentimeter shattered_bleed ticks -159238 93644 312 19.45 778 0 17.2 97.3 0.0% 0.0% 0.0% 0.0% 17.82sec 130677 300.95sec
Zentimeter Zentimeter water_elemental 31687 0 0 0.20 0 0 1.0 1.0 9.5% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Zentimeter Zentimeter_water_elemental water_jet ticks -135029 121837 406 7.95 2207 4467 10.0 39.7 12.6% 0.0% 0.0% 0.0% 30.31sec 121837 300.95sec
Zentimeter Zentimeter_water_elemental waterbolt 31707 599643 1992 22.95 3754 7582 116.0 115.1 11.8% 0.0% 0.0% 0.0% 2.58sec 599643 300.95sec
Zambo Zambo avenging_wrath 31884 0 0 0.59 0 0 3.0 3.0 16.3% 0.0% 0.0% 0.0% 121.50sec 0 300.95sec
Zambo Zambo censure ticks -31803 219607 732 19.87 1818 3649 297.2 99.4 12.7% 0.0% 0.0% 0.0% 1.01sec 219607 300.95sec
Zambo Zambo crusader_strike 35395 513020 1705 12.36 6814 13697 62.0 62.0 12.6% 0.0% 0.0% 0.0% 4.83sec 788430 300.95sec
Zambo Zambo divine_storm 53385 509756 1694 4.05 20659 41515 20.3 20.3 12.5% 0.0% 0.0% 0.0% 13.94sec 509756 300.95sec
Zambo Zambo draenic_strength_potion 156428 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Zambo Zambo execution_sentence ticks -114157 373369 1245 10.69 5690 11704 5.5 53.4 13.2% 0.0% 0.0% 0.0% 60.78sec 373369 300.95sec
Zambo Zambo exorcism 879 104552 347 1.83 9383 18763 9.2 9.2 12.5% 0.0% 0.0% 0.0% 18.08sec 104552 300.95sec
Zambo Zambo final_verdict 157048 1724123 5729 13.32 21245 42665 66.8 66.8 12.6% 0.0% 0.0% 0.0% 4.47sec 1724123 300.95sec
Zambo Zambo glyph_of_divine_storm 63220 0 0 4.05 0 0 20.3 20.3 15.9% 0.0% 0.0% 0.0% 13.94sec 276592 300.95sec
Zambo Zambo hammer_of_wrath 24275 599938 1993 6.06 16188 32741 30.4 30.4 12.8% 0.0% 0.0% 0.0% 10.10sec 599938 300.95sec
Zambo Zambo hand_of_light 96172 2021920 6718 45.08 8941 0 226.1 226.1 0.0% 0.0% 0.0% 0.0% 1.67sec 2021920 300.95sec
Zambo Zambo judgment 20271 452297 1503 7.85 9446 19020 39.4 39.4 12.7% 0.0% 0.0% 0.0% 7.61sec 452297 300.95sec
Zambo Zambo melee 0 738704 2455 19.66 6158 12386 98.6 98.6 12.7% 0.0% 0.0% 0.0% 3.04sec 1135272 300.95sec
Zambo Zambo seal_of_truth_proc 31801 413243 1373 59.25 1141 2296 297.2 297.2 12.9% 0.0% 0.0% 0.0% 1.01sec 413243 300.95sec
Zambo Zambo shattered_bleed 159238 35144 117 3.49 1651 3307 17.5 17.5 12.9% 0.0% 0.0% 0.0% 17.48sec 118107 300.95sec
Zambo Zambo shattered_bleed ticks -159238 82963 277 19.55 787 0 17.5 97.7 0.0% 0.0% 0.0% 0.0% 17.48sec 118107 300.95sec
Swæty Swæty devouring_plague 2944 601392 1998 4.38 21604 43203 22.0 22.0 18.7% 0.0% 0.0% 0.0% 13.14sec 601392 300.95sec
Swæty Swæty devouring_plague_tick ticks -2944 591078 1970 26.81 3672 0 26.9 134.0 0.0% 0.0% 0.0% 0.0% 10.63sec 0 300.95sec
Swæty Swæty draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Swæty Swæty halo 120644 0 0 1.34 0 0 6.7 6.7 18.4% 0.0% 0.0% 0.0% 48.04sec 0 300.95sec
Swæty Swæty halo_damage 120696 203608 677 1.34 23983 47966 6.7 6.7 18.6% 0.0% 0.0% 0.0% 48.04sec 203608 300.95sec
Swæty Swæty insanity ticks -129197 918695 3062 19.04 7611 15221 35.4 95.2 18.7% 0.0% 0.0% 0.0% 7.86sec 918695 300.95sec
Swæty Swæty mind_blast 8092 1689469 5614 11.40 23313 46614 57.2 57.2 18.7% 0.0% 0.0% 0.0% 5.30sec 1689469 300.95sec
Swæty Swæty mind_spike 73510 1283750 4266 13.45 15002 30004 67.5 67.5 18.7% 0.0% 0.0% 0.0% 4.37sec 1283750 300.95sec
Swæty Swæty shadow_word_death 32379 410875 1365 2.31 27987 55961 11.6 11.6 18.5% 0.0% 0.0% 0.0% 5.36sec 410880 300.95sec
Swæty Swæty shadow_word_pain 589 33033 110 1.52 3414 6831 7.6 7.6 18.6% 0.0% 0.0% 0.0% 30.50sec 239977 300.95sec
Swæty Swæty shadow_word_pain ticks -589 206943 690 10.18 3202 6401 7.6 50.9 18.6% 0.0% 0.0% 0.0% 30.50sec 239977 300.95sec
Swæty Swæty shadowy_apparitions 78203 37842 126 1.89 3142 6285 9.5 9.5 18.8% 0.0% 0.0% 0.0% 22.24sec 37842 300.95sec
Swæty Swæty shadowfiend 34433 0 0 0.40 0 0 2.0 2.0 18.6% 0.0% 0.0% 0.0% 188.85sec 0 300.95sec
Swæty Swæty shadowform 15473 0 0 0.20 0 0 1.0 1.0 19.1% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Swæty Swæty shattered_bleed 159238 34217 114 3.41 1578 3156 17.1 17.1 18.7% 0.0% 0.0% 0.0% 17.97sec 114554 300.95sec
Swæty Swæty shattered_bleed ticks -159238 80337 268 19.28 780 0 17.1 96.4 0.0% 0.0% 0.0% 0.0% 17.97sec 114554 300.95sec
Swæty Swæty vampiric_touch ticks -34914 211308 704 8.64 3847 7695 7.5 43.2 18.6% 0.0% 0.0% 0.0% 31.24sec 211308 300.95sec
Swæty Swæty_shadowfiend melee 0 135753 5643 49.94 5350 10704 20.0 20.0 18.6% 0.0% 0.0% 0.0% 10.60sec 135753 24.06sec
Swæty Swæty_shadowfiend shadowcrawl 63619 0 0 15.00 0 0 6.0 6.0 18.6% 0.0% 0.0% 0.0% 40.51sec 0 24.06sec
Ralana Ralana adrenaline_rush 13750 0 0 0.78 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 85.99sec 0 300.95sec
Ralana Ralana ambush 8676 130765 435 1.41 14500 28983 7.1 7.1 21.1% 0.0% 0.0% 0.0% 48.84sec 200964 300.95sec
Ralana Ralana auto_attack_mh 0 1346652 4475 43.47 4840 9681 218.1 218.1 21.2% 0.0% 0.0% 0.0% 1.38sec 2069591 300.95sec
Ralana Ralana auto_attack_oh 1 660884 2196 42.76 2417 4832 214.5 214.5 21.1% 0.0% 0.0% 0.0% 1.40sec 1015675 300.95sec
Ralana Ralana draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Ralana Ralana eviscerate 2098 973248 3234 7.22 21062 42142 36.2 36.2 21.2% 0.0% 0.0% 0.0% 7.93sec 1495728 300.95sec
Ralana Ralana instant_poison 157607 602988 2004 41.88 2250 4501 210.0 210.0 21.2% 0.0% 0.0% 0.0% 1.46sec 602988 300.95sec
Ralana Ralana killing_spree 51690 0 0 1.14 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 56.90sec 0 300.95sec
Ralana Ralana killing_spree_mh ticks -57841 243717 812 0.00 4650 9296 40.0 0.0 21.2% 0.0% 0.0% 0.0% 6.99sec 364698 300.95sec
Ralana Ralana killing_spree_oh ticks -57842 121785 406 0.00 2325 4651 40.0 0.0 21.1% 0.0% 0.0% 0.0% 6.99sec 182233 300.95sec
Ralana Ralana main_gauche 86392 900849 2993 43.25 3257 6509 216.9 216.9 21.1% 0.0% 0.0% 0.0% 1.46sec 1384463 300.95sec
Ralana Ralana preparation 14185 0 0 0.24 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 313.61sec 0 300.95sec
Ralana Ralana revealing_strike 84617 88865 295 2.53 5487 10968 12.7 12.7 21.1% 0.0% 0.0% 0.0% 24.25sec 1127009 300.95sec
Ralana Ralana sinister_strike 1752 1206648 4009 26.23 7190 14379 131.6 131.6 21.1% 0.0% 0.0% 0.0% 2.25sec 1854427 300.95sec
Ralana Ralana slice_and_dice 5171 0 0 1.95 0 0 9.8 9.8 0.0% 0.0% 0.0% 0.0% 32.15sec 0 300.95sec
Ralana Ralana vanish 1856 0 0 1.21 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 48.83sec 0 300.95sec
Mîrai Mîrai ambush 8676 907855 3017 6.44 18992 40830 32.3 32.3 27.1% 0.0% 0.0% 0.0% 9.11sec 981640 300.95sec
Mîrai Mîrai auto_attack_mh 0 1471557 4890 63.68 3756 8167 319.4 319.4 25.1% 19.0% 0.0% 0.0% 0.94sec 1736563 300.95sec
Mîrai Mîrai auto_attack_oh 1 723379 2404 63.17 1860 4049 316.9 316.9 25.0% 19.0% 0.0% 0.0% 0.95sec 856078 300.95sec
Mîrai Mîrai backstab 53 844059 2805 16.59 7121 15252 83.2 83.2 24.2% 0.0% 0.0% 0.0% 3.44sec 1048695 300.95sec
Mîrai Mîrai deadly_poison_dot ticks -2818 268233 894 19.89 1890 4001 199.8 99.5 24.9% 0.0% 0.0% 0.0% 1.50sec 268233 300.95sec
Mîrai Mîrai deadly_poison_instant 113780 279402 928 39.63 982 2088 198.8 198.8 25.0% 0.0% 0.0% 0.0% 1.51sec 279402 300.95sec
Mîrai Mîrai draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Mîrai Mîrai eviscerate 2098 1376178 4573 6.94 27321 59360 34.8 34.8 25.3% 0.0% 0.0% 0.0% 8.51sec 1559709 300.95sec
Mîrai Mîrai garrote ticks -703 12383 41 1.80 910 1865 1.0 9.0 33.7% 0.0% 0.0% 0.0% 0.00sec 12383 300.95sec
Mîrai Mîrai premeditation 14183 0 0 1.70 0 0 8.5 8.5 0.0% 0.0% 0.0% 0.0% 38.48sec 0 300.95sec
Mîrai Mîrai preparation 14185 0 0 0.23 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 312.69sec 0 300.95sec
Mîrai Mîrai rupture ticks -1943 1230905 4103 38.11 4529 9584 16.6 190.6 24.9% 0.0% 0.0% 0.0% 18.52sec 1230905 300.95sec
Mîrai Mîrai shadow_dance 51713 0 0 1.06 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 61.88sec 0 300.95sec
Mîrai Mîrai shadow_reflection 152151 0 0 0.57 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 124.25sec 0 300.95sec
Mîrai Mîrai shattered_bleed 159238 79015 263 6.83 1639 3347 34.3 34.3 25.0% 0.0% 0.0% 0.0% 9.20sec 223656 300.95sec
Mîrai Mîrai shattered_bleed ticks -159238 144641 482 33.21 779 0 34.3 166.0 0.0% 0.0% 0.0% 0.0% 9.20sec 223656 300.95sec
Mîrai Mîrai slice_and_dice 5171 0 0 1.76 0 0 8.8 8.8 0.0% 0.0% 0.0% 0.0% 35.84sec 0 300.95sec
Mîrai Mîrai vanish 1856 0 0 0.84 0 0 4.2 4.2 0.0% 0.0% 0.0% 0.0% 71.91sec 0 300.95sec
Mîrai Mîrai_shadow_reflection ambush 8676 182188 4056 13.78 11876 24061 10.3 10.3 32.3% 0.0% 0.0% 0.0% 24.72sec 279995 44.92sec
Mîrai Mîrai_shadow_reflection backstab 53 693 15 0.11 5740 11722 0.1 0.1 33.7% 0.0% 0.0% 0.0% 84.05sec 1065 44.92sec
Mîrai Mîrai_shadow_reflection eviscerate 2098 97019 2160 3.60 24291 49399 2.7 2.7 31.4% 0.0% 0.0% 0.0% 107.30sec 149103 44.92sec
Mîrai Mîrai_shadow_reflection rupture ticks -1943 113344 378 4.20 3754 7903 1.8 21.0 25.9% 0.0% 0.0% 0.0% 162.03sec 113344 44.92sec
Shaerlyn Shaerlyn ascendance 165339 0 0 0.40 0 0 2.0 2.0 15.3% 0.0% 0.0% 0.0% 181.22sec 0 300.95sec
Shaerlyn Shaerlyn draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Shaerlyn Shaerlyn earth_shock 8042 261980 870 3.23 9694 24223 16.2 16.2 15.4% 0.0% 0.0% 0.0% 18.22sec 261980 300.95sec
Shaerlyn Shaerlyn fulmination 88766 709693 2358 3.23 26242 65578 16.2 16.2 15.4% 0.0% 0.0% 0.0% 18.22sec 709693 300.95sec
Shaerlyn Shaerlyn elemental_mastery 16166 0 0 0.60 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 121.13sec 0 300.95sec
Shaerlyn Shaerlyn fire_elemental_totem 2894 0 0 0.30 0 0 1.5 1.5 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Shaerlyn Shaerlyn flame_shock 8050 72400 241 2.14 4050 10137 10.7 10.7 15.4% 0.0% 0.0% 0.0% 29.18sec 504406 300.95sec
Shaerlyn Shaerlyn flame_shock ticks -8050 432006 1440 25.02 2067 5169 10.7 125.1 15.3% 0.0% 0.0% 0.0% 29.18sec 504406 300.95sec
Shaerlyn Shaerlyn lava_burst 51505 2981442 9907 12.07 0 34356 60.7 60.6 100.0% 0.0% 0.0% 0.0% 4.90sec 2981442 300.95sec
Shaerlyn Shaerlyn lightning_bolt 403 1954860 6496 19.12 12250 30633 96.2 95.9 15.3% 0.0% 0.0% 0.0% 2.90sec 1954860 300.95sec
Shaerlyn Shaerlyn lightning_shield 324 0 0 0.20 0 0 1.0 1.0 15.4% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Shaerlyn Shaerlyn molten_earth 170379 1245961 4140 25.00 5956 14890 125.9 125.4 15.3% 0.0% 0.0% 0.0% 2.38sec 1245961 300.95sec
Shaerlyn Shaerlyn searing_totem 3599 0 0 0.77 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 65.86sec 0 300.95sec
Shaerlyn Shaerlyn unleash_flame 165462 0 0 3.67 0 0 18.4 18.4 0.0% 0.0% 0.0% 0.0% 16.77sec 0 300.95sec
Shaerlyn Shaerlyn_greater_fire_elemental fire_blast 57984 15269 198 9.92 771 1926 12.7 12.7 15.4% 0.0% 0.0% 0.0% 15.57sec 15269 76.97sec
Shaerlyn Shaerlyn_greater_fire_elemental melee 0 197944 2572 57.25 1729 4324 73.4 73.4 15.4% 0.0% 0.0% 0.0% 2.55sec 197944 76.97sec
Shaerlyn Shaerlyn_searing_totem searing_bolt 3606 246772 1189 35.45 1295 3239 122.9 122.6 15.3% 0.0% 0.0% 0.0% 1.82sec 246772 207.55sec
Candylicious Candylicious chaos_bolt 116858 1580500 5252 4.87 0 59297 24.6 24.4 100.0% 0.0% 0.0% 0.0% 12.09sec 1580500 300.95sec
Candylicious Candylicious conflagrate 17962 559399 1859 5.26 14907 30673 26.4 26.4 28.8% 0.0% 0.0% 0.0% 11.57sec 559399 300.95sec
Candylicious Candylicious dark_soul 113858 0 0 0.60 0 0 3.0 3.0 20.5% 0.0% 0.0% 0.0% 120.97sec 0 300.95sec
Candylicious Candylicious draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Candylicious Candylicious immolate 348 207269 689 4.11 7209 14821 20.6 20.6 26.5% 0.0% 0.0% 0.0% 14.91sec 811333 300.95sec
Candylicious Candylicious immolate ticks -348 604064 2014 24.15 3581 7338 20.6 120.7 26.7% 0.0% 0.0% 0.0% 14.91sec 811333 300.95sec
Candylicious Candylicious incinerate 29722 1954543 6495 27.17 10411 21299 137.2 136.3 25.1% 0.0% 0.0% 0.0% 2.18sec 1954543 300.95sec
Candylicious Candylicious shattered_bleed 159238 36649 122 3.56 1554 3108 17.9 17.9 21.1% 0.0% 0.0% 0.0% 17.16sec 120532 300.95sec
Candylicious Candylicious shattered_bleed ticks -159238 83883 280 20.03 767 0 17.9 100.1 0.0% 0.0% 0.0% 0.0% 17.16sec 120532 300.95sec
Candylicious Candylicious summon_terrorguard 112927 0 0 0.40 0 0 1.0 2.0 18.5% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Candylicious Candylicious_terrorguard doom_bolt 85692 1832272 6088 20.88 12502 25545 105.4 104.7 27.1% 0.0% 0.0% 0.0% 2.84sec 1832272 300.95sec
Dârkride Dârkride auto_attack_mh 0 739874 2458 26.58 4466 9034 133.3 133.3 19.0% 0.0% 0.0% 0.0% 2.27sec 1137070 300.95sec
Dârkride Dârkride berserker_rage 18499 0 0 1.82 0 0 9.1 9.1 0.0% 0.0% 0.0% 0.0% 34.46sec 0 300.95sec
Dârkride Dârkride blood_craze 159362 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 16.18sec 137439 300.95sec
Dârkride Dârkride bloodbath ticks -113344 379213 1264 18.43 4115 0 5.5 92.1 0.0% 0.0% 0.0% 0.0% 60.04sec 379213 300.95sec
Dârkride Dârkride charge 100 0 0 0.20 0 0 1.0 1.0 16.6% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Dârkride Dârkride deep_wounds ticks -115767 590336 1968 19.73 4828 9738 120.7 98.7 18.8% 0.0% 0.0% 0.0% 2.47sec 590336 300.95sec
Dârkride Dârkride devastate 20243 1310700 4355 24.07 8731 17701 120.7 120.7 19.0% 0.0% 0.0% 0.0% 2.47sec 2014340 300.95sec
Dârkride Dârkride draenic_armor_potion 156430 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.95sec
Dârkride Dârkride dragon_roar 118000 160683 534 1.07 0 28753 5.4 5.4 100.0% 0.0% 0.0% 0.0% 61.11sec 160683 300.95sec
Dârkride Dârkride execute 5308 207923 691 1.32 25397 50860 6.6 6.6 18.5% 0.0% 0.0% 0.0% 7.95sec 319545 300.95sec
Dârkride Dârkride heroic_leap 6544 23496 78 1.37 2729 5626 6.9 6.9 19.5% 0.0% 0.0% 0.0% 46.04sec 36110 300.95sec
Dârkride Dârkride heroic_strike 78 1216257 4041 37.29 4978 10188 187.0 187.0 24.5% 0.0% 0.0% 0.0% 1.61sec 1869196 300.95sec
Dârkride Dârkride revenge 6572 561745 1867 6.02 14993 30286 30.2 30.2 19.0% 0.0% 0.0% 0.0% 10.09sec 863313 300.95sec
Dârkride Dârkride shattered_bleed 159238 43626 145 3.39 2076 4160 17.0 17.0 18.9% 0.0% 0.0% 0.0% 18.05sec 123342 300.95sec
Dârkride Dârkride shattered_bleed ticks -159238 79716 266 19.24 796 0 17.0 96.2 0.0% 0.0% 0.0% 0.0% 18.05sec 123342 300.95sec
Dârkride Dârkride shield_charge 156321 0 0 4.24 0 0 21.3 21.3 0.0% 0.0% 0.0% 0.0% 14.53sec 0 300.95sec
Dârkride Dârkride shield_slam 23922 1367757 4545 13.33 16423 33392 66.9 66.9 19.1% 0.0% 0.0% 0.0% 4.52sec 2102027 300.95sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

DPS Taken Timeline Chart
http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=374|1:|0|&chxp=1,1,-1,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.55% 10.55% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.42% 10.42% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.63% 10.63% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.10% 11.10% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.53% 10.53% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.55% 10.55% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.59% 11.59% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.59%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.91% 7.91% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.91%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.43% 5.43% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.43%

Trigger Attempt Success

  • trigger_pct:100.00%
censure 1.0 296.2 0.0sec 1.0sec 99.55% 100.00% 292.2(292.2)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • censure_1:0.34%
  • censure_2:0.11%
  • censure_3:0.24%
  • censure_4:0.34%
  • censure_5:98.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
find_weakness 9.5 23.8 33.0sec 9.1sec 48.68% 48.68% 23.8(23.8)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • find_weakness_1:48.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:$w1% of armor is ignored by the attacking Rogue.
  • description:Your Ambush, Garrote, and Cheap Shot abilities reveal a flaw in your target's defenses, causing all your attacks to bypass a portion of that enemy's armor for {$91021d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.3sec 30.3sec 11.47% 17.17% 0.0(0.0)

Buff details

  • buff initial source:Procrank_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.3sec 30.3sec 11.23% 16.52% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 303923.91
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 34764
death count pct 139.03
avg death time 300.49
min death time 227.72
max death time 374.63
dmg taken 91476477.97

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 25000
Mean 300.95
Minimum 227.72
Maximum 374.63
Spread ( max - min ) 146.91
Range [ ( max - min ) / 2 * 100% ] 24.41%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 25000
Mean 304582.57
Minimum 290421.25
Maximum 320894.97
Spread ( max - min ) 30473.71
Range [ ( max - min ) / 2 * 100% ] 5.00%
Standard Deviation 5302.5502
5th Percentile 295987.76
95th Percentile 312360.82
( 95th Percentile - 5th Percentile ) 16373.06
Mean Distribution
Standard Deviation 33.5363
95.00% Confidence Intervall ( 304516.84 - 304648.30 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1164
0.1 Scale Factor Error with Delta=300 240023
0.05 Scale Factor Error with Delta=300 960092
0.01 Scale Factor Error with Delta=300 24002321
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 6145
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 109523641 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Multistrike 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1938 1938 1938
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=103
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.